Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00099 ACP5 Homo sapiens Yes Metabolism

HuProt v2.0
Block Row Column Clone
48 1 7 JHU00099
48 1 8 JHU00099
HuProt v3.0
Block Row Column Clone
3 5 32 JHU00099
3 6 32 JHU00099
HuProt v3.1
Block Row Column Clone
3 5 32 JHU00099
3 6 32 JHU00099

External Database ID

Nucleotide (978bp)

>JHU00099
ATGGACATGTGGACGGCGCTGCTCATCCTGCAAGCCTTGTTGCTACCCTCCCTGGCTGATGGTGCCACCCCTGCCCTGCG
CTTTGTAGCCGTGGGTGACTGGGGAGGGGTCCCCAATGCCCCATTCCACACGGCCCGGGAAATGGCCAATGCCAAGGAGA
TCGCTCGGACTGTGCAGATCCTGGGTGCAGACTTCATCCTGTCTCTAGGGGACAATTTTTACTTCACTGGTGTGCAAGAC
ATCAATGACAAGAGGTTCCAGGAGACCTTTGAGGACGTATTCTCTGACCGCTCCCTTCGCAAAGTGCCCTGGTACGTGCT
AGCCGGAAACCATGACCACCTTGGCAATGTCTCTGCCCAGATTGCATACTCTAAGATCTCCAAGCGCTGGAACTTCCCCA
GCCCTTTCTACCGCCTGCACTTCAAGATCCCACAGACCAATGTGTCTGTGGCCATTTTTATGCTGGACACAGTGACACTA
TGTGGCAACTCAGATGACTTCCTCAGCCAGCAGCCTGAGAGGCCCCGAGACGTGAAGCTGGCCCGCACACAGCTGTCCTG
GCTCAAGAAACAGCTGGCGGCGGCCAGGGAGGACTACGTGCTGGTGGCTGGCCACTACCCCGTGTGGTCCATAGCCGAGC
ACGGGCCTACCCACTGCCTGGTCAAGCAGCTACGGCCACTGCTGGCCACATACGGGGTCACTGCCTACCTGTGCGGCCAC
GATCACAATCTGCAGTACCTGCAAGATGAGAATGGCGTGGGCTACGTGCTGAGTGGGGCTGGGAATTTCATGGACCCCTC
AAAGCGGCACCAGCGCAAGGTCCCCAACGGCTATCTGCGCTTCCACTATGGGACTGAAGACTCACTGGGTGGCTTTGCCT
ATGTGGAGATCAGCTCCAAAGAGATGACTGTCACTTACATCGAGGCCTCGGGCAAGTCCCTCTTTAAGACCAGGCTGCCG
AGGCGAGCCAGGCCCTAG

Protein (325aa)

>JHU00099
MDMWTALLILQALLLPSLADGATPALRFVAVGDWGGVPNAPFHTAREMANAKEIARTVQILGADFILSLGDNFYFTGVQD
INDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTVTL
CGNSDDFLSQQPERPRDVKLARTQLSWLKKQLAAAREDYVLVAGHYPVWSIAEHGPTHCLVKQLRPLLATYGVTAYLCGH
DHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLP
RRARP