Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00009 STRADB ALS2CR2;ILPIP Homo sapiens Yes Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
2 1 7 JHU00009
2 1 8 JHU00009
HuProt v3.0
Block Row Column Clone
3 3 3 JHU00009
3 4 3 JHU00009
HuProt v3.1
Block Row Column Clone
3 3 3 JHU00009
3 4 3 JHU00009

External Database ID

Nucleotide (1257bp)

>JHU00009
ATGTCTCTTTTGGATTGCTTCTGCACTTCAAGAACACAAGTTGAATCACTCAGACCTGAAAAACAGTCTGAAACCAGTAT
CCATCAATACTTGGTTGATGAGCCAACCCTTTCCTGGTCACGTCCATCCACTAGAGCCAGTGAAGTACTATGTTCCACCA
ACGTTTCTCACTATGAGCTCCAAGTAGAAATAGGAAGAGGATTTGACAACTTGACTTCTGTCCATCTTGCACGGCATACT
CCCACGGGAACACTGGTAACTATAAAAATTACAAATCTGGAAAACTGCAATGAAGAACGCCTGAAAGCTTTACAGAAAGC
CGTGATTCTATCCCACTTTTTCCGGCATCCCAATATTACAACTTATTGGACAGTTTTCACTGTTGGCAGCTGGCTTTGGG
TTATTTCTCCATTTATGGCCTATGGTTCAGCAAGTCAACTCTTGAGGACCTATTTTCCTGAAGGAATGAGTGAAACTTTA
ATAAGAAACATTCTCTTTGGAGCCGTGAGAGGGTTGAACTATCTGCACCAAAATGGCTGTATTCACAGGAGTATTAAAGC
CAGCCATATCCTCATTTCTGGTGATGGCCTAGTGACCCTCTCTGGCCTTTCCCATCTGCATAGTTTGGTTAAGCATGGAC
AGAGGCATAGGGCTGTGTATGATTTCCCACAGTTCAGCACATCAGTGCAGCCGTGGCTGAGTCCAGAACTACTGAGACAG
GATTTACATGGGTATAATGTGAAGTCAGATATTTACAGTGTTGGGATTACAGCATGTGAATTAGCCAGTGGGCAGGTGCC
TTTCCAGGACATGCATAGAACTCAGATGCTGTTACAGAAACTGAAAGGTCCTCCTTATAGCCCATTGGATATCAGTATTT
TCCCTCAATCAGAATCCAGAATGAAAAATTCCCAGTCAGGTGTAGACTCTGGGATTGGAGAAAGTGTGCTTGTCTCCAGT
GGAACTCACACAGTAAATAGTGACCGATTACACACACCATCCTCAAAAACTTTCTCTCCTGCCTTCTTTAGCTTGGTACA
GCTCTGTTTGCAACAAGATCCTGAGAAAAGGCCATCAGCAAGCAGTTTATTGTCCCATGTTTTCTTCAAACAGATGAAAG
AAGAAAGCCAGGATTCAATACTTTCACTGTTGCCTCCTGCTTATAACAAGCCATCAATATCATTGCCTCCAGTGTTACCT
TGGACTGAGCCAGAATGTGATTTTCCTGATGAAAAAGACTCATACTGGGAATTCTAG

Protein (418aa)

>JHU00009
MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDNLTSVHLARHT
PTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPEGMSETL
IRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLVKHGQRHRAVYDFPQFSTSVQPWLSPELLRQ
DLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSS
GTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLP
WTEPECDFPDEKDSYWEF