Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00085 SYT17 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
28 1 5 JHU00085
28 1 6 JHU00085
HuProt v3.0
Block Row Column Clone
3 1 26 JHU00085
3 2 26 JHU00085
HuProt v3.1
Block Row Column Clone
3 1 26 JHU00085
3 2 26 JHU00085

External Database ID

Nucleotide (1425bp)

>JHU00085
ATGGCGTACATCCAGTTGGAACCATTAAACGAGGGTTTTCTTTCTAGAATCTCTGGTCTGCTGCTGTGCAGATGGACCTG
CCGGCACTGCTGTCAGAAGTGCTACGAGTCCAGCTGTTGCCAGTCAAGTGAGGATGAAGTTGAAATTCTGGGACCTTTCC
CTGCTCAGACCCCTCCCTGGCTGATGGCCAGCCGGAGCAGTGACAAGGATGGTGACTCTGTCCACACGGCCAGCGAAGTC
CCGCTGACCCCACGGACCAATTCCCCGGATGGAAGACGCTCGTCCTCAGACACATCCAAGTCTACATACAGCCTGACGCG
GAGGATTTCGAGTCTTGAGTCAAGACGTCCCAGCTCTCCACTCATCGATATTAAACCCATCGAGTTTGGCGTTCTCAGCG
CCAAGAAGGAGCCCATCCAACCTTCGGTGCTCAGACGGACCTATAACCCCGACGACTATTTCAGGAAGTTCGAACCCCAC
CTGTACTCCCTCGACTCCAACAGCGACGATGTGGACTCTCTGACAGACGAGGAGATCCTGTCCAAGTACCAGCTGGGCAT
GCTGCACTTCAGCACTCAGTACGACCTGCTGCACAACCACCTCACCGTGCGTGTGATCGAGGCCAGGGACCTGCCACCTC
CCATCTCCCACGATGGCTCGCGCCAGGACATGGCGCACTCCAACCCCTACGTCAAGATCTGTCTCCTGCCAGACCAGAAG
AACTCAAAGCAGACCGGGGTCAAACGCAAGACCCAGAAGCCCGTGTTTGAGGAGCGCTACACCTTCGAGATCCCCTTCCT
GGAGGCCCAGAGGAGGACCCTGCTCCTGACCGTGGTGGATTTTGATAAGTTCTCCCGCCACTGTGTCATTGGGAAAGTTT
CTGTGCCTTTGTGTGAAGTTGACCTGGTCAAGGGCGGGCACTGGTGGAAGGCGCTGATTCCCAGTTCTCAGAATGAAGTG
GAGCTGGGGGAGCTGCTTCTGTCACTGAATTATCTCCCAAGTGCTGGCAGACTGAATGTTGATGTCATTCGAGCCAAGCA
ACTTCTTCAGACAGATGTGAGCCAAGGTTCAGACCCCTTTGTGAAAATCCAGCTGGTGCATGGACTCAAACTTGTGAAAA
CCAAGAAGACGTCCTTCTTAAGGGGCACAATTGATCCTTTCTACAATGAATCCTTCAGCTTCAAAGTTCCCCAAGAAGAA
CTGGAAAATGCCAGCCTAGTGTTTACAGTTTTCGGCCACAACATGAAGAGCAGCAATGACTTCATCGGGAGGATCGTCAT
TGGCCAGTACTCTTCAGGCCCCTCTGAGACCAACCACTGGAGGCGCATGCTCAACACGCACCGCACAGCCGTGGAGCAGT
GGCATAGCCTGAGGTCCCGAGCTGAGTGTGACCGCGTGTCTCCTGCCTCCCTGGAGGTGACCTAG

Protein (474aa)

>JHU00085
MAYIQLEPLNEGFLSRISGLLLCRWTCRHCCQKCYESSCCQSSEDEVEILGPFPAQTPPWLMASRSSDKDGDSVHTASEV
PLTPRTNSPDGRRSSSDTSKSTYSLTRRISSLESRRPSSPLIDIKPIEFGVLSAKKEPIQPSVLRRTYNPDDYFRKFEPH
LYSLDSNSDDVDSLTDEEILSKYQLGMLHFSTQYDLLHNHLTVRVIEARDLPPPISHDGSRQDMAHSNPYVKICLLPDQK
NSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDKFSRHCVIGKVSVPLCEVDLVKGGHWWKALIPSSQNEV
ELGELLLSLNYLPSAGRLNVDVIRAKQLLQTDVSQGSDPFVKIQLVHGLKLVKTKKTSFLRGTIDPFYNESFSFKVPQEE
LENASLVFTVFGHNMKSSNDFIGRIVIGQYSSGPSETNHWRRMLNTHRTAVEQWHSLRSRAECDRVSPASLEVT