Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00081 SQSTM1 ORCA;OSIL Homo sapiens Yes Cell Death; Kinases; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
20 1 5 JHU00081
20 1 6 JHU00081
HuProt v3.0
Block Row Column Clone
3 1 20 JHU00081
3 2 20 JHU00081
HuProt v3.1
Block Row Column Clone
3 1 20 JHU00081
3 2 20 JHU00081

External Database ID

Nucleotide (1323bp)

>JHU00081
ATGGCGTCGCTCACCGTGAAGGCCTACCTTCTGGGCAAGGAGGACGCGGCGCGCGAGATTCGCCGCTTCAGCTTCTGCTG
CAGCCCCGAGCCTGAGGCGGAAGCCGAGGCTGCGGCGGGTCCGGGACCCTGCGAGCGGCTGCTGAGCCGGGTGGCCGCCC
TGTTCCCCGCGCTGCGGCCTGGCGGCTTCCAGGCGCACTACCGCGATGAGGACGGGGACTTGGTTGCCTTTTCCAGTGAC
GAGGAATTGACAATGGCCATGTCCTACGTGAAGGATGACATCTTCCGAATCTACATTAAAGAGAAAAAAGAGTGCCGGCG
GGACCACCGCCCACCGTGTGCTCAGGAGGCGCCCCGCAACATGGTGCACCCCAATGTGATCTGCGATGGCTGCAATGGGC
CTGTGGTAGGAACCCGCTACAAGTGCAGCGTCTGCCCAGACTACGACTTGTGTAGCGTCTGCGAGGGAAAGGGCTTGCAC
CGGGGGCACACCAAGCTCGCATTCCCCAGCCCCTTCGGGCACCTGTCTGAGGGCTTCTCGCACAGCCGCTGGCTCCGGAA
GGTGAAACACGGACACTTCGGGTGGCCAGGATGGGAAATGGGTCCACCAGGAAACTGGAGCCCACGTCCTCCTCGTGCAG
GGGAGGCCCGCCCTGGCCCCACGGCAGAATCAGCTTCTGGTCCATCGGAGGATCCGAGTGTGAATTTCCTGAAGAACGTT
GGGGAGAGTGTGGCAGCTGCCCTTAGCCCTCTGGGCATTGAAGTTGATATCGATGTGGAGCACGGAGGGAAAAGAAGCCG
CCTGACCCCCGTCTCTCCAGAGAGTTCCAGCACAGAGGAGAAGAGCAGCTCACAGCCAAGCAGCTGCTGCTCTGATCCCA
GCAAGCCGGGTGGGAATGTTGAGGGCGCCACGCAGTCTCTGGCGGAGCAGATGAGAAAGATCGCCTTGGAGTCCGAGGGG
CGCCCTGAGGAACAGATGGAGTCGGATAACTGTTCAGGAGGAGATGATGACTGGACCCATCTGTCTTCAAAAGAAGTGGA
CCCGTCTACAGGTGAACTCCAGTCCCTACAGATGCCAGAATCCGAAGGGCCAAGCTCTCTGGACCCCTCCCAGGAGGGAC
CCACAGGGCTGAAGGAAGCTGCCTTGTACCCACATCTCCCGCCAGAGGCTGACCCGCGGCTGATTGAGTCCCTCTCCCAG
ATGCTGTCCATGGGCTTCTCTGATGAAGGCGGCTGGCTCACCAGGCTCCTGCAGACCAAGAACTATGACATCGGAGCGGC
TCTGGACACCATCCAGTATTCAAAGCATCCCCCGCCGTTGTAG

Protein (440aa)

>JHU00081
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSD
EELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLH
RGHTKLAFPSPFGHLSEGFSHSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEG
RPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQ
MLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL