Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00008 AKAP10 Homo sapiens Yes Cell Death; Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
5 24 25 JHU00008
5 24 26 JHU00008
HuProt v3.0
Block Row Column Clone
18 43 7 JHU00008
18 44 7 JHU00008
HuProt v3.1
Block Row Column Clone
18 43 7 JHU00008
18 44 7 JHU00008

External Database ID

Nucleotide (1989bp)

>JHU00008
ATGAGGGGAGCCGGGCCCTCCCCGCGCCAGTCCCCCCGCACCCTCCGTCCCGACCCGGGCCCCGCCATGTCCTTCTTCCG
GCGGAAAGTGAAAGGCAAAGAACAAGAGAAGACCTCAGATGTGAAGTCCATTAAAGCTTCAATATCCGTACATTCCCCAC
AAAAAAGCACTAAAAATCATGCCTTGCTGGAGGCTGCAGGACCAAGTCATGTTGCAATCAATGCCATTTCTGCCAACATG
GACTCCTTTTCAAGTAGCAGGACAGCCACACTTAAGAAGCAGCCAAGCCACATGGAGGCCGCTCATTTTGGTGACCTGGG
CAGATCTTGTCTGGACTACCAGACTCAAGAGACCAAATCAAGCCTTTCTAAGACCCTTGAACAAGTCTTGCACGACACTA
TTGTCCTCCCTTACTTCATTCAATTCATGGAACTTCGGCGAATGGAGCATTTGGTGAAATTTTGGTTAGAGGCTGAAAGT
TTTCATTCAACAACTTGGTCGCGAATAAGAGCACACAGTCTAAACACAGTGAAGCAGAGCTCACTGGCTGAGCCTGTCTC
TCCATCTAAAAAGCATGAAACTACAGCGTCTTTTTTAACTGATTCTCTTGATAAGAGATTGGAGGATTCTGGCTCAGCAC
AGTTGTTTATGACTCATTCAGAAGGAATTGACCTGAATAATAGAACTAACAGCACTCAGAATCACTTGCTGCTTTCCCAG
GAATGTGACAGTGCCCATTCTCTCCGTCTTGAAATGGCCAGAGCAGGAACTCACCAAGTTTCCATGGAAACCCAAGAATC
TTCCTCTACACTTACAGTAGCCAGTAGAAATAGTCCCGCTTCTCCACTAAAAGAATTGTCAGGAAAACTAATGAAAAGTA
TAGAACAAGATGCAGTGAATACTTTTACCAAATATATATCTCCAGATGCTGCTAAACCAATACCAATTACAGAAGCAATG
AGAAATGACATCATAGCAAGGATTTGTGGAGAAGATGGACAGGTGGATCCCAACTGTTTCGTTTTGGCACAGTCCATAGT
CTTTAGTGCAATGGAGCAAGAGCACTTTAGTGAGTTTCTGCGAAGTCACCATTTCTGTAAATACCAGATTGAAGTGCTGA
CCAGTGGAACTGTTTACCTGGCTGACATTCTCTTCTGTGAGTCAGCCCTCTTTTATTTCTCTGAGTACATGGAAAAAGAG
GATGCAGTGAATATCTTACAATTCTGGTTGGCAGCAGATAACTTCCAGTCTCAGCTTGCTGCCAAAAAGGGCCAATATGA
TGGACAGGAGGCACAGAATGATGCCATGATTTTATATGACAAGTACTTCTCCCTCCAAGCCACACATCCTCTTGGATTTG
ATGATGTTGTACGATTAGAAATTGAATCCAATATCTGCAGGGAAGGTGGGCCACTCCCCAACTGTTTCACAACTCCATTA
CGTCAGGCCTGGACAACCATGGAGAAGGTCTTTTTGCCTGGCTTTTTGTCCAGCAATCTTTATTATAAATATTTGAATGA
TCTCATCCATTCGGTTCGAGGAGATGAATTTCTGGGCGGGAACGTGTCGCTGACTGCTCCTGGCTCTGTTGGCCCTCCTG
ATGAGTCTCACCCAGGGAGTTCTGACAGCTCTGCGTCTCAGTCCAGTGTGAAAAAAGCCAGTATTAAAATACTGAAAAAT
TTTGATGAAGCGATAATTGTGGATGCGGCAAGTCTGGATCCAGAATCTTTATATCAACGGACATATGCCGGGAAGATGAC
ATTTGGAAGAGTCAGTGACTTGGGGCAATTCATCCGAGAATCTGAGCCTGAACCTGATGTAAGGAAATCAAAAGGATCCA
TGTTCTCACAAGCTATGAAGAAATGGGTGCAAGGAAATACTGATGAGGCCCAGGAAGAGCTAGCTTGGAAGATTGCTAAA
ATGATAGTCAGTGACATTATGCAGCAGGCTCAGTATGATCAACCGTTAGAGAAATCTACAAAGTTATAG

Protein (662aa)

>JHU00008
MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANM
DSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKSSLSKTLEQVLHDTIVLPYFIQFMELRRMEHLVKFWLEAES
FHSTTWSRIRAHSLNTVKQSSLAEPVSPSKKHETTASFLTDSLDKRLEDSGSAQLFMTHSEGIDLNNRTNSTQNHLLLSQ
ECDSAHSLRLEMARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVNTFTKYISPDAAKPIPITEAM
RNDIIARICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILFCESALFYFSEYMEKE
DAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPNCFTTPL
RQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLTAPGSVGPPDESHPGSSDSSASQSSVKKASIKILKN
FDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAK
MIVSDIMQQAQYDQPLEKSTKL