Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00079 SKAP2 PRAP;RA70;SAPS;SCAP2;SKAP55R Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
12 1 3 JHU00079
12 1 4 JHU00079
12 1 7 JHU00079
12 1 8 JHU00079
26 1 5 JHU00079
26 1 6 JHU00079
41 1 11 JHU00079
41 1 12 JHU00079
23 1 11 JHU00079
23 1 12 JHU00079
21 24 31 JHU00079
21 24 32 JHU00079
HuProt v3.0
Block Row Column Clone
4 3 26 JHU00079
4 4 26 JHU00079
3 3 26 JHU00079
3 4 26 JHU00079
3 1 23 JHU00079
3 2 23 JHU00079
2 5 25 JHU00079
2 6 25 JHU00079
2 5 10 JHU00079
2 6 10 JHU00079
17 47 7 JHU00079
17 48 7 JHU00079
HuProt v3.1
Block Row Column Clone
4 3 26 JHU00079
4 4 26 JHU00079
3 3 26 JHU00079
3 4 26 JHU00079
3 1 23 JHU00079
3 2 23 JHU00079
2 5 25 JHU00079
2 6 25 JHU00079
2 5 10 JHU00079
2 6 10 JHU00079
17 47 7 JHU00079
17 48 7 JHU00079

External Database ID

Nucleotide (1080bp)

>JHU00079
ATGCCCAACCCCAGCAGCACCTCCTCTCCCTACCCCCTCCCTGAGGAAATTAGGAACCTGTTGGCAGATGTTGAAACATT
TGTAGCAGATATACTGAAAGGAGAAAATTTATCCAAGAAAGCAAAGGAAAAGAGAGAATCCCTTATTAAGAAGATAAAAG
ATGTAAAGTCTATCTATCTTCAGGAATTTCAAGACAAAGGTGATGCAGAAGATGGGGAAGAATATGATGACCCTTTTGCT
GGGCCTCCAGACACTATTTCATTAGCCTCAGAACGATATGATAAAGACGATGAAGCCCCCTCTGATGGAGCCCAGTTTCC
TCCAATTGCAGCACAAGACCTTCCTTTTGTTCTAAAGGCTGGCTACCTTGAAAAACGCAGAAAAGATCACAGCTTTCTGG
GATTTGAATGGCAGAAACGGTGGTGTGCTCTCAGTAAAACGGTATTCTATTATTATGGAAGTGATAAAGACAAACAACAG
AAAGGTGAATTTGCAATAGATGGCTACAGTGTCAGAATGAATAACACTCTAAGAAAGGATGGAAAGAAAGATTGCTGTTT
TGAAATCTCTGCTCCTGATAAACGTATATATCAGTTTACAGCAGCTTCTCCCAAAGATGCTGAAGAATGGGTACAGCAGC
TGAAATTTGTATTGCAAGATATGGAATCTGATATTATTCCTGAGGATTATGATGAGAGAGGAGAATTATATGATGATGTT
GATCATCCTCTACCAATAAGCAATCCACTAACAAGCAGTCAACCAATAGATGATGAAATTTATGAAGAACTTCCAGAAGA
AGAAGAGGACAGTGCTCCAGTGAAAGTGGAAGAACAAAGGAAGATGAGTCAGGATAGTGTCCATCACACCTCAGGGGATA
AGAGCACTGATTATGCTAATTTTTACCAGGGATTGTGGGATTGTACTGGAGCTTTTTCTGATGAGTTGTCATTTAAGCGT
GGTGATGTGATTTACATTCTTAGCAAGGAATACAATAGATATGGCTGGTGGGTAGGAGAAATGAAGGGAGCCATTGGCTT
GGTGCCTAAAGCCTACATAATGGAGATGTATGATATTTAG

Protein (359aa)

>JHU00079
MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFA
GPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQ
KGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDV
DHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKR
GDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI