Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU07093 STK3 KRS1;MST2 Homo sapiens Yes Cell Death; Kinases; Nuclear Proteins; Signal Transduction; Transcription Factors

HuProt v2.0
Block Row Column Clone
32 1 13 JHU07093
32 1 14 JHU07093
19 1 9 JHU07093
19 1 10 JHU07093
3 1 15 JHU07093
3 1 16 JHU07093
16 10 5 JHU07093
16 10 6 JHU07093
39 24 31 JHU07093
39 24 32 JHU07093
HuProt v3.0
Block Row Column Clone
1 1 32 JHU07093
1 2 32 JHU07093
2 1 4 JHU07093
2 2 4 JHU07093
1 3 4 JHU07093
1 4 4 JHU07093
7 49 14 JHU07093
7 50 14 JHU07093
17 47 18 JHU07093
17 48 18 JHU07093
HuProt v3.1
Block Row Column Clone
1 1 32 JHU07093
1 2 32 JHU07093
2 1 4 JHU07093
2 2 4 JHU07093
1 3 4 JHU07093
1 4 4 JHU07093
17 47 18 JHU07093
17 48 18 JHU07093
6 53 17 JHU07093
6 54 17 JHU07093

External Database ID

Nucleotide (1476bp)

>JHU07093
ATGGAGCAGCCGCCGGCGCCTAAGAGTAAACTAAAAAAGCTGAGTGAAGACAGTTTGACTAAGCAGCCTGAAGAAGTTTT
TGATGTATTAGAGAAGCTTGGAGAAGGGTCTTATGGAAGTGTATTTAAAGCAATACACAAGGAATCCGGTCAAGTTGTCG
CAATTAAACAAGTACCTGTTGAATCAGATCTTCAGGAAATAATCAAAGAAATTTCCATAATGCAGCAATGTGACAGCCCA
TATGTTGTAAAGTACTATGGCAGTTATTTTAAGAATACAGACCTCTGGATTGTTATGGAGTACTGTGGCGCTGGCTCTGT
CTCAGACATAATTAGATTACGAAACAAGACATTAATAGAAGATGAAATTGCAACCATTCTTAAATCTACATTGAAAGGAC
TAGAATATTTGCACTTTATGAGAAAAATACACAGAGATATAAAAGCTGGAAATATTCTCCTCAATACAGAAGGACATGCA
AAATTGGCAGATTTTGGAGTGGCTGGTCAGTTAACAGATACAATGGCAAAACGCAATACTGTAATAGGAACTCCATTTTG
GATGGCTCCTGAGGTGATTCAAGAAATAGGCTATAACTGTGTGGCCGACATCTGGTCCCTTGGCATTACTTCTATAGAAA
TGGCTGAAGGAAAACCTCCTTATGCTGATATACATCCAATGAGGGCTATTTTTATGATTCCCACAAATCCACCACCAACA
TTCAGAAAGCCAGAACTTTGGTCCGATGATTTCACCGATTTTGTTAAAAAGTGTTTGGTGAAGAATCCTGAGCAGAGAGC
TACTGCAACACAACTTTTACAGCATCCTTTTATCAAGAATGCCAAACCTGTATCAATATTAAGAGACCTGATCACAGAAG
CTATGGAGATCAAAGCTAAAAGACATGAGGAACAGCAACGAGAATTGGAAGAGGAAGAAGAAAATTCGGATGAAGATGAG
CTGGATTCCCACACCATGGTGAAGACTAGTGTGGAGAGTGTGGGCACCATGCGGGCCACAAGCACGATGAGTGAAGGGGC
CCAGACCATGATTGAACATAATAGCACGATGTTGGAATCCGACTTGGGGACCATGGTGATAAACAGTGAGGATGAGGAAG
AAGAAGATGGAACTATGAAAAGAAATGCAACCTCACCACAAGTACAAAGACCATCTTTCATGGACTACTTTGATAAGCAA
GACTTCAAGAATAAGAGTCACGAAAACTGTAATCAGAACATGCATGAACCCTTCCCTATGTCCAAAAACGTTTTTCCTGA
TAACTGGAAAGTTCCTCAAGATGGAGACTTTGACTTTTTGAAAAATCTAAGTTTAGAAGAACTACAGATGCGGTTAAAAG
CACTGGACCCCATGATGGAACGGGAGATAGAAGAACTTCGTCAGAGATACACTGCGAAAAGACAGCCCATTCTGGATGCG
ATGGATGCAAAGAAAAGAAGGCAGCAAAACTTTTAG

Protein (491aa)

>JHU07093
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSP
YVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHA
KLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDE
LDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ
DFKNKSHENCNQNMHEPFPMSKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF