Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00007 AKAP1 AKAP149;PRKA1 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
36 1 1 JHU00007
36 1 2 JHU00007
HuProt v3.0
Block Row Column Clone
4 3 2 JHU00007
4 4 2 JHU00007
HuProt v3.1
Block Row Column Clone
4 3 2 JHU00007
4 4 2 JHU00007

External Database ID

Nucleotide (2712bp)

>JHU00007
ATGGCAATCCAGTTCCGTTCGCTCTTCCCCTTGGCATTGCCTGGGATGCTGGCGCTCCTCGGCTGGTGGTGGTTTTTCTC
TCGTAAAAAAGGCCATGTCAGCAGCCATGATGAGCAGCAGGTGGAGGCTGGTGCTGTGCAGCTGAGGGCTGACCCTGCCA
TCAAGGAACCTCTCCCCGTGGAAGACGTCTGTCCCAAAGTAGTGTCCACACCCCCCAGTGTCACAGAGCCTCCAGAAAAG
GAACTGTCCACCGTGAGCAAGCTGCCTGCAGAGCCCCCAGCATTGCTCCAGACACACCCACCTTGCCGAAGATCAGAGTC
CTCGGGCATTCTTCCTAACACCACAGACATGAGATTGCGACCAGGAACACGCAGAGATGACAGTACAAAGCTGGAGCTAG
CCCTGACAGGTGGTGAAGCCAAATCGATTCCTCTAGAGTGCCCCCTTTCATCCCCAAAGGGTGTACTATTCTCCAGCAAA
TCAGCTGAGGTGTGTAAGCAAGATTCCCCCTTCAGCAGGGTGCCAAGGAAGGTCCAGCCAGGCTACCCCGTAGTCCCCGC
AGAGAAGCGTAGCTCTGGGGAGAGGGCAAGAGAGACAGGTGGGGCCGAAGGGACTGGTGATGCCGTGTTGGGGGAAAAGG
TGCTTGAAGAAGCTCTGTTGTCTCGGGAGCATGTCTTGGAATTGGAGAACAGCAAGGGCCCCAGCCTGGCCTCTTTAGAG
GGGGAAGAAGATAAGGGGAAGAGCAGCTCATCCCAGGTGGTGGGGCCAGTGCAGGAGGAAGAGTATGTAGCAGAGAAGTT
GCCAAGTAGGTTCATCGAGTCGGCTCACACAGAGCTGGCAAAGGACGATGCGGCGCCAGCACCCCCAGTCGCAGACGCCA
AAGCCCAGGATAGAGGTGTCGAGGGAGAACTGGGCAATGAGGAGAGCTTGGATAGAAATGAGGAGGGCTTGGATAGAAAT
GAGGAGGGCTTGGATAGAAATGAGGAGAGCTTGGATAGAAATGAGGAGGGCTTGGATAGAAATGAGGAGATTAAGCGGGC
TGCCTTCCAGATAATCTCCCAAGTGATCTCAGAAGCAACCGAACAGGTGCTGGCCACCACGGTTGGCAAGGTTGCAGGTC
GTGTGTGTCAGGCCAGTCAGCTCCAAGGGCAGAAGGAAGAGAGCTGTGTCCCAGTTCACCAGAAAACTGTCTTGGGCCCA
GACACTGCGGAGCCTGCCACAGCAGAGGCAGCTGTTGCCCCGCCGGATGCTGGCCTCCCCTTGCCAGGCCTACCAGCAGA
GGGCTCACCACCACCAAAGACCTACGTGAGCTGCCTGAAGAGCCTTCTGTCCAGCCCCACCAAGGACAGTAAGCCAAATA
TCTCTGCACACCACATCTCCCTGGCCTCCTGCCTGGCACTGACCACCCCCAGTGAAGAGTTGCCGGACCGGGCAGGCATC
CTGGTGGAAGATGCCACCTGTGTCACCTGCATGTCAGACAGCAGCCAAAGTGTCCCTTTGGTGGCTTCTCCAGGACACTG
CTCAGATTCTTTCAGCACTTCAGGGCTTGAAGACTCTTGCACAGAGACCAGCTCGAGCCCCAGGGACAAGGCCATCACCC
CGCCACTGCCAGAAAGTACTGTGCCCTTCAGCAATGGGGTGCTGAAGGGGGAGTTGTCAGACTTGGGGGCTGAGGATGGA
TGGACCATGGATGCGGAAGCAGATCATTCAGGAGGTTCTGACAGGAACAGCATGGATTCCGTGGATAGCTGTTGCAGTCT
CAAGAAGACTGAGAGCTTCCAAAATGCCCAGGCAGGCTCCAACCCTAAGAAGGTCGACCTCATCATCTGGGAGATCGAGG
TGCCAAAGCACTTAGTCGGTCGGCTAATTGGCAAGCAGGGGCGCTATGTGAGTTTTCTGAAGCAAACATCTGGTGCCAAG
ATCTACATTTCAACCCTGCCTTACACCCAGAGCGTCCAGATCTGCCACATAGAAGGCTCTCAACATCATGTAGACAAAGC
GCTGAACTTGATTGGGAAGAAGTTCAAAGAGCTGAACCTCACCAATATCTACGCTCCCCCATTGCCTTCACTGGCACTGC
CTTCTCTGCCGATGACATCCTGGCTCATGCTGCCTGATGGCATCACCGTGGAGGTCATTGTGGTCAACCAGGTCAATGCC
GGGCACCTGTTCGTGCAGCAGCACACACACCCTACCTTCCACGCGCTGCGCAGCCTCGACCAGCAGATGTACCTCTGTTA
CTCTCAGCCTGGAATCCCCACCTTGCCCACCCCAGTGGAAATAACGGTCATCTGTGCCGCCCCTGGTGCGGACGGGGCCT
GGTGGCGAGCCCAAGTGGTTGCCTCCTACGAGGAGACCAACGAAGTGGAGATTCGATACGTGCACTACGGCGGATATAAG
AGGGTGAAAGTAGACGTGCTCCGGCAAATCAGGTCTGACTTTGTCACCCTGCCGTTTCAGGGAGCAGAAGTCCTTCTGGA
CAGTGTGATGCCCCTGTCAGACGATGACCAGTTTTCACCGGAAGCAGATGCCGCCATGAGCGAGATGACGGGGAATACAG
CACTGCTTGCTCAGGTGACAAGTTACAGTCCAACTGGTCTTCCTCTGATTCAGCTGTGGAGTGTGGTTGGAGATGAAGTG
GTGTTGATAAACCGGTCCCTGGTGGAGCGAGGCCTTGCCCAGTGGGTAGACAGCTACTACACAAGCCTTTAG

Protein (903aa)

>JHU00007
MAIQFRSLFPLALPGMLALLGWWWFFSRKKGHVSSHDEQQVEAGAVQLRADPAIKEPLPVEDVCPKVVSTPPSVTEPPEK
ELSTVSKLPAEPPALLQTHPPCRRSESSGILPNTTDMRLRPGTRRDDSTKLELALTGGEAKSIPLECPLSSPKGVLFSSK
SAEVCKQDSPFSRVPRKVQPGYPVVPAEKRSSGERARETGGAEGTGDAVLGEKVLEEALLSREHVLELENSKGPSLASLE
GEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRN
EEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQVLATTVGKVAGRVCQASQLQGQKEESCVPVHQKTVLGP
DTAEPATAEAAVAPPDAGLPLPGLPAEGSPPPKTYVSCLKSLLSSPTKDSKPNISAHHISLASCLALTTPSEELPDRAGI
LVEDATCVTCMSDSSQSVPLVASPGHCSDSFSTSGLEDSCTETSSSPRDKAITPPLPESTVPFSNGVLKGELSDLGAEDG
WTMDAEADHSGGSDRNSMDSVDSCCSLKKTESFQNAQAGSNPKKVDLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAK
IYISTLPYTQSVQICHIEGSQHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSWLMLPDGITVEVIVVNQVNA
GHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICAAPGADGAWWRAQVVASYEETNEVEIRYVHYGGYK
RVKVDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEV
VLINRSLVERGLAQWVDSYYTSL