Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00068 PIP4K2A PIP5K2;PIP5K2A Homo sapiens Yes Kinases; Membrane Proteins; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
34 1 7 JHU00068
34 1 8 JHU00068
HuProt v3.0
Block Row Column Clone
3 5 3 JHU00068
3 6 3 JHU00068
HuProt v3.1
Block Row Column Clone
3 5 3 JHU00068
3 6 3 JHU00068

External Database ID

Nucleotide (1221bp)

>JHU00068
ATGGCGACCCCCGGCAACCTAGGGTCCTCTGTCCTGGCGAGCAAGACCAAGACCAAGAAGAAGCACTTCGTAGCGCAGAA
AGTGAAGCTGTTTCGGGCCAGCGACCCGCTGCTCAGCGTCCTCATGTGGGGGGTAAACCACTCGATCAATGAACTGAGCC
ATGTTCAAATCCCTGTTATGTTGATGCCAGATGACTTCAAAGCCTATTCAAAAATAAAGGTGGACAATCACCTTTTTAAC
AAAGAAAACATGCCGAGCCATTTCAAGTTTAAGGAATACTGCCCGATGGTCTTCCGTAACCTGCGGGAGAGGTTTGGAAT
TGATGATCAAGATTTCCAGAATTCCCTGACCAGGAGCGCACCCCTCCCCAACGACTCCCAGGCCCGCAGTGGAGCTCGTT
TTCACACTTCCTACGACAAAAGATACATCATCAAGACTATTACCAGTGAAGACGTGGCCGAAATGCACAACATCCTGAAG
AAATACCACCAGTACATAGTGGAATGTCATGGGATCACCCTTCTTCCCCAGTTCTTGGGCATGTACCGGCTTAATGTTGA
TGGAGTTGAAATATATGTGATAGTTACAAGAAATGTATTCAGCCACCGTTTGTCTGTGTATAGGAAATACGACTTAAAGG
GCTCTACAGTGGCTAGAGAAGCTAGTGACAAAGAAAAGGCCAAAGAACTGCCAACTCTGAAAGATAATGATTTCATTAAT
GAGGGCCAAAAGATTTATATTGATGACAACAACAAGAAGGTCTTCCTGGAAAAACTAAAAAAGGATGTTGAGTTTCTGGC
CCAGCTGAAGCTCATGGACTACAGTCTGCTGGTGGGAATTCATGATGTGGAGAGAGCCGAACAGGAGGAAGTGGAGTGTG
AGGAGAACGATGGGGAGGAGGAGGGCGAGAGCGATGGCACCCACCCGGTGGGAACCCCCCCAGATAGCCCCGGGAATACA
CTGAACAGCTCACCACCCCTGGCTCCCGGGGAGTTCGATCCGAACATCGACGTCTATGGAATTAAGTGCCATGAAAACTC
GCCTAGGAAGGAGGTGTACTTCATGGCAATTATTGACATCCTTACTCATTATGATGCAAAAAAGAAAGCTGCCCATGCTG
CAAAAACTGTTAAACATGGCGCTGGCGCGGAGATCTCCACCGTGAACCCAGAACAGTATTCAAAGCGCTTTTTGGACTTT
ATTGGCCACATCTTGACGTAG

Protein (406aa)

>JHU00068
MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVMLMPDDFKAYSKIKVDNHLFN
KENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMHNILK
KYHQYIVECHGITLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAKELPTLKDNDFIN
EGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVECEENDGEEEGESDGTHPVGTPPDSPGNT
LNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDF
IGHILT