Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00066 PHKG2 Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
12 1 5 JHU00066
12 1 6 JHU00066
HuProt v3.0
Block Row Column Clone
3 1 12 JHU00066
3 2 12 JHU00066
HuProt v3.1
Block Row Column Clone
3 1 12 JHU00066
3 2 12 JHU00066

External Database ID

Nucleotide (1221bp)

>JHU00066
ATGACGCTGGACGTGGGGCCGGAGGATGAGCTGCCCGACTGGGCCGCCGCCAAAGAGTTTTACCAGAAGTACGACCCTAA
GGACGTCATCGGCAGAGGAGTGAGCTCTGTGGTCCGCCGTTGTGTTCATCGAGCTACTGGCCACGAGTTTGCGGTGAAGA
TTATGGAAGTGACAGCTGAGCGGCTGAGTCCTGAGCAGCTGGAGGAGGTGCGGGAAGCCACACGGCGAGAGACACACATC
CTTCGCCAGGTCGCCGGCCACCCCCACATCATCACCCTCATCGATTCCTACGAGTCTTCTAGCTTCATGTTCCTGGTGTT
TGACCTGATGCGGAAGGGAGAGCTGTTTGACTATCTCACAGAGAAGGTGGCCCTCTCTGAAAAGGAAACCAGGTCCATCA
TGCGGTCTCTGCTGGAAGCAGTGAGCTTTCTCCATGCCAACAACATTGTGCATCGAGATCTGAAGCCCGAGAATATTCTC
CTAGATGACAATATGCAGATCCGACTTTCAGATTTCGGGTTCTCCTGCCACTTGGAACCTGGCGAGAAGCTTCGAGAGTT
GTGTGGGACCCCAGGGTATCTAGCGCCAGAGATCCTTAAATGCTCCATGGATGAAACCCACCCAGGCTATGGCAAGGAGG
TCGACCTCTGGGCCTGTGGGGTGATCTTGTTCACACTCCTGGCTGGCTCGCCACCCTTCTGGCACCGGCGGCAGATCCTG
ATGTTACGCATGATCATGGAGGGCCAGTACCAGTTCAGTTCCCCCGAGTGGGATGACCGTTCCAGCACTGTCAAAGACCT
GATCTCCAGGCTGCTGCAGGTGGATCCTGAGGCACGCCTGACAGCTGAGCAGGCCCTACAGCACCCCTTCTTTGAGCGTT
GTGAAGGCAGCCAACCCTGGAACCTCACCCCCCGCCAGCGGTTCCGGGTGGCAGTGTGGACAGTGCTGGCTGCTGGACGA
GTGGCCCTAAGCACCCATCGTGTACGGCCACTGACCAAGAATGCACTGTTGAGGGACCCTTATGCGCTGCGGTCAGTGCG
GCACCTCATCGACAACTGTGCCTTCCGGCTCTACGGGCACTGGGTAAAGAAAGGGGAGCAGCAGAACCGGGCGGCTCTCT
TTCAGCACCGGCCCCCTGGGCCTTTTCCCATCATGGGCCCTGAAGAGGAGGGAGACTCTGCTGCTATAACTGAGGATGAG
GCCGTGCTTGTGCTGGGCTAG

Protein (406aa)

>JHU00066
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAERLSPEQLEEVREATRRETHI
LRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLTEKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENIL
LDDNMQIRLSDFGFSCHLEPGEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPWNLTPRQRFRVAVWTVLAAGR
VALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGHWVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDE
AVLVLG