Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00063 PDK3 PDHK3 Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
18 1 11 JHU00063
18 1 12 JHU00063
20 24 17 JHU00063
20 24 18 JHU00063
HuProt v3.0
Block Row Column Clone
2 5 5 JHU00063
2 6 5 JHU00063
20 43 20 JHU00063
20 44 20 JHU00063
HuProt v3.1
Block Row Column Clone
2 5 5 JHU00063
2 6 5 JHU00063
20 43 20 JHU00063
20 44 20 JHU00063

External Database ID

Nucleotide (1221bp)

>JHU00063
ATGCGGCTGTTCCGGTGGCTGCTGAAGCAGCCGGTGCCCAAGCAGATCGAGCGCTACTCGCGCTTTTCGCCGTCGCCGCT
CTCCATCAAACAATTCCTGGACTTCGGGAGAGATAATGCATGTGAGAAAACTTCATATATGTTTCTACGAAAGGAACTTC
CTGTGCGGCTGGCTAACACAATGAGAGAAGTTAATCTTCTGCCGGATAATTTACTTAACCGCCCTTCAGTGGGATTGGTT
CAGAGTTGGTATATGCAGAGTTTTCTTGAACTTTTAGAATATGAAAATAAGAGCCCTGAGGATCCACAGGTCTTGGATAA
CTTTCTACAAGTTCTGATTAAAGTCAGAAATAGACACAATGATGTGGTTCCTACAATGGCACAAGGAGTGATTGAATACA
AGGAGAAGTTTGGGTTTGATCCTTTCATTAGCACTAACATCCAATATTTTCTGGATCGGTTTTATACCAACCGCATCTCT
TTCCGCATGCTTATTAATCAGCACACACTTCTGTTTGGGGGTGACACTAATCCTGTTCATCCTAAACACATAGGAAGTAT
CGATCCCACCTGTAACGTGGCGGATGTGGTGAAAGATGCATATGAAACAGCCAAGATGCTGTGTGAACAGTATTACCTGG
TAGCTCCAGAGCTGGAAGTTGAAGAATTCAATGCCAAAGCGCCAGACAAACCTATTCAGGTGGTTTATGTGCCCTCACAT
CTGTTTCATATGCTATTTGAGTTGTTCAAGAACTCAATGAGAGCGACAGTTGAACTCTATGAAGACAGAAAAGAGGGCTA
CCCTGCTGTTAAAACCCTCGTTACTTTGGGTAAAGAAGACTTATCCATTAAGATCAGTGACCTAGGTGGTGGTGTCCCAC
TTCGAAAAATAGATCGTCTTTTTAACTACATGTATTCTACTGCTCCTAGACCCAGCCTGGAGCCTACCAGAGCTGCCCCT
TTGGCTGGATTTGGTTATGGTTTGCCAATTTCCCGTCTGTATGCTAGATATTTTCAAGGAGATCTGAAACTGTATTCCAT
GGAAGGAGTGGGTACTGATGCTGTCATTTATTTGAAGGCTCTTTCAAGTGAGTCATTTGAGAGACTTCCAGTTTTTAATA
AGTCCGCATGGCGCCATTACAAGACCACGCCTGAAGCCGATGATTGGAGCAATCCCAGCAGTGAACCCAGGGATGCTTCA
AAATACAAAGCAAAACAGTAG

Protein (406aa)

>JHU00063
MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDNLLNRPSVGLV
QSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVVPTMAQGVIEYKEKFGFDPFISTNIQYFLDRFYTNRIS
FRMLINQHTLLFGGDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAP
LAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDAS
KYKAKQ