Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00062 PDGFRA PDGFR2;RHEPDGFRA Homo sapiens Yes Kinases; Membrane Proteins; Metabolism; Signal Transduction

HuProt v2.0
Block Row Column Clone
36 1 3 JHU00062
36 1 4 JHU00062
15 24 25 JHU00062
15 24 26 JHU00062
HuProt v3.0
Block Row Column Clone
4 5 20 JHU00062
4 6 20 JHU00062
18 43 30 JHU00062
18 44 30 JHU00062
HuProt v3.1
Block Row Column Clone
4 5 20 JHU00062
4 6 20 JHU00062
18 43 30 JHU00062
18 44 30 JHU00062

External Database ID

Nucleotide (657bp)

>JHU00062
ATGGGGACTTCCCATCCGGCGTTCCTGGTCTTAGGCTGTCTTCTCACAGGGCTGAGCCTAATCCTCTGCCAGCTTTCATT
ACCCTCTATCCTTCCAAATGAAAATGAAAAGGTTGTGCAGCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTG
AAGTGAGCTGGCAGTACCCCATGTCTGAAGAAGAGAGCTCCGATGTGGAAATCAGAAATGAAGAAAACAACAGCGGCCTT
TTTGTGACGGTCTTGGAAGTGAGCAGTGCCTCGGCGGCCCACACAGGGTTGTACACTTGCTATTACAACCACACTCAGAC
AGAAGAGAATGAGCTTGAAGGCAGGCACATTTACATCTATGTGCCAGACCCAGATGTAGCCTTTGTACCTCTAGGAATGA
CGGATTATTTAGTCATCGTGGAGGATGATGATTCTGCCATTATACCTTGTCGCACAACTGATCCCGAGACTCCTGTAACC
TTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTAATGGGACCTTCACTGTAGGGCCCTA
TATCTGTGAGGCCACCGTCAAAGGAAAGAAGTTCCAGACCATCCCATTTAATGTTTATGCTTTAAAAGGTACTTGTATCA
TCTCCTTCCTTCTTTAG

Protein (218aa)

>JHU00062
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGL
FVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVT
LHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKGTCIISFLL