Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06143 ZNF398 KIAA1339;ZER6 Homo sapiens Yes Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
29 8 25 JHU06143
29 8 26 JHU06143
HuProt v3.0
Block Row Column Clone
6 31 31 JHU06143
6 32 31 JHU06143
HuProt v3.1
Block Row Column Clone
6 31 31 JHU06143
6 32 31 JHU06143

External Database ID

Nucleotide (1929bp)

>JHU06143
ATGGCTGAGGCGGCCCCGGCCCCGACATCTGAATGGGACTCCGAGTGCCTTACATCCCTGCAGCCCCTTCCTCTTCCTAC
ACCCCCAGCAGCAAATGAGGCACACCTGCAGACAGCAGCTATCTCTCTGTGGACAGTGGTGGCCGCCGTGCAGGCTATAG
AGAGGAAGGTGGAGATCCACAGCCGGCGACTCCTACACCTAGAAGGTCGGACAGGGACAGCAGAGAAGAAACTAGCCAGC
TGTGAAAAGACAGTTACCGAGCTTGGGAACCAGCTGGAGGGCAAGTGGGCCGTGCTGGGAACCCTGCTGCAGGAGTACGG
GCTGCTGCAGAGGCGGCTGGAGAACTTGGAGAACCTGCTGCGCAACAGGAACTTCTGGATCCTGCGGCTCCCTCCAGGTA
TTAAGGGAGATATCCCAAAGGTGCCTGTGGCATTTGATGATGTCTCCATCTACTTTTCCACTCCAGAGTGGGAAAAATTA
GAAGAATGGCAAAAGGAACTTTACAAGAATATCATGAAGGGCAACTACGAGTCTCTCATCTCCATGGATTATGCTATAAA
TCAACCTGATGTCTTATCTCAGATTCAACCAGAAGGGGAACATAATACAGAGGACCAGGCAGGGCCAGAGGAAAGTGAGA
TTCCCACAGACCCCAGTGAAGAGCCTGGTATTTCAACATCAGATATTCTGTCTTGGATTAAACAAGAAGAAGAGCCTCAG
GTTGGGGCCCCACCGGAGTCCAAGGAGAGTGACGTGTACAAAAGCACTTATGCTGATGAAGAGCTTGTCATCAAAGCTGA
AGGCCTTGCTAGATCCTCGTTGTGCCCTGAGGTTCCAGTCCCTTTCTCTTCTCCACCAGCAGCAGCAAAGGATGCTTTTT
CAGATGTGGCTTTCAAAAGCCAGCAGTCTACATCCATGACACCTTTTGGACGTCCAGCCACTGACCTGCCTGAAGCCTCT
GAGGGACAAGTGACTTTTACTCAGTTGGGTAGCTATCCCCTCCCACCTCCAGTTGGCGAGCAGGTGTTCTCATGCCACCA
CTGTGGCAAGAATCTCAGCCAAGACATGTTGCTGACCCACCAATGTAGCCATGCTACTGAGCACCCCTTACCCTGTGCCC
AGTGCCCTAAGCACTTTACTCCACAGGCGGACCTCAGCAGCACCTCCCAGGACCATGCCAGCGAGACACCCCCCACCTGC
CCACACTGTGCCAGGACTTTTACTCACCCATCAAGACTTACCTACCATCTTCGGGTCCATAACAGCACTGAGCGTCCTTT
CCCCTGTCCTGATTGCCCCAAGCGCTTTGCTGACCAGGCTCGACTCACCAGCCACCGGAGAGCTCATGCAAGCGAAAGGC
CCTTCCGCTGTGCCCAGTGCGGCAGGAGCTTCAGCTTGAAAATCAGCCTCCTGCTCCACCAGCGGGGTCATGCACAAGAG
CGCCCTTTCTCCTGCCCTCAGTGTGGCATTGACTTCAACGGCCACTCGGCCCTGATCCGCCACCAGATGATCCACACAGG
CGAGCGTCCTTACCCCTGCACTGACTGCAGTAAGAGCTTCATGCGCAAGGAGCACCTGCTGAACCACCGGCGGCTGCACA
CAGGCGAGCGGCCCTTCAGTTGTCCTCACTGTGGCAAGAGCTTCATCCGCAAGCACCACCTAATGAAACACCAGCGCATC
CACACCGGGGAGCGGCCCTACCCCTGCTCCTACTGTGGCAGGAGCTTCCGCTACAAACAGACACTCAAGGACCACCTCCG
TTCAGGCCACAATGGAGGCTGTGGGGGTGATAGTGACCCATCAGGTCAGCCACCCAACCCACCAGGTCCCCTCATAACTG
GGCTTGAAACTTCTGGCCTGGGTGTCAACACTGAAGGTCTAGAGACCAACCAGTGGTATGGGGAAGGGAGTGGAGGGGGA
GTTTTGTAG

Protein (642aa)

>JHU06143
MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAVQAIERKVEIHSRRLLHLEGRTGTAEKKLAS
CEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRLENLENLLRNRNFWILRLPPGIKGDIPKVPVAFDDVSIYFSTPEWEKL
EEWQKELYKNIMKGNYESLISMDYAINQPDVLSQIQPEGEHNTEDQAGPEESEIPTDPSEEPGISTSDILSWIKQEEEPQ
VGAPPESKESDVYKSTYADEELVIKAEGLARSSLCPEVPVPFSSPPAAAKDAFSDVAFKSQQSTSMTPFGRPATDLPEAS
EGQVTFTQLGSYPLPPPVGEQVFSCHHCGKNLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTC
PHCARTFTHPSRLTYHLRVHNSTERPFPCPDCPKRFADQARLTSHRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQE
RPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFSCPHCGKSFIRKHHLMKHQRI
HTGERPYPCSYCGRSFRYKQTLKDHLRSGHNGGCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGG
VL