Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06125 STXBP3 Homo sapiens Yes Membrane Proteins

HuProt v2.0
Block Row Column Clone
15 8 25 JHU06125
15 8 26 JHU06125
HuProt v3.0
Block Row Column Clone
6 31 30 JHU06125
6 32 30 JHU06125
HuProt v3.1
Block Row Column Clone
6 31 30 JHU06125
6 32 30 JHU06125

External Database ID

Nucleotide (1779bp)

>JHU06125
ATGGCGCCGCCGGTGGCAGAGAGGGGGCTAAAGAGCGTCGTGTGGCAGAAGATAAAAGCAACAGTGTTTGATGACTGCAA
GAAAGAAGGCGAATGGAAGATAATGCTTTTAGATGAATTTACCACTAAGCTTTTGGCATCGTGTTGCAAAATGACAGATC
TTCTAGAAGAAGGTATTACTGTTGTAGAGAATATTTATAAGAACCGTGAACCTGTCAGACAAATGAAAGCTCTTTATTTC
ATCACTCCGACATCAAAGTCTGTAGATTGTTTCTTACATGATTTTGCAAGTAAATCGGAGAACAAGTATAGAGCAGCATA
TATTTACTTCACTGACTTTTGCCCTGATAATCTCTTTAACAAAATTAAGGCTTCTTGCTCCAAGTCAATAAGAAGATGTA
AAGAAATAAATATTTCCTTCATTCCACATGAATCTCAGGTGTATACTCGTGATGTACCAGATGCATTCTATTACTGTTAT
AGTCCAGACCCTGGTAATGCAAAGGGAAAAGATGCCATTATGGAAACAATGGCTGACCAGATAGTTACAGTGTGTGCCAC
CTTGGATGAAAATCCCGGAGTAAGATATAAAAGTAAACCTCTAGATAATGCCAGTAAGCTTGCACAGCTTGTTGAAAAAA
AGCTTGAAGACTACTACAAGATTGATGAAAAGAGCCTAATAAAGGGTAAAACTCATTCACAGCTCTTAATAATTGATCGT
GGCTTTGATCCTGTGTCCACTGTCCTGCATGAACTGACCTTTCAGGCAATGGCATATGATCTACTACCAATTGAGAATGA
TACATACAAATATAAAACAGATGGAAAAGAAAAGGAGGCCATCCTTGAAGAAGAAGATGACCTCTGGGTTAGAATTCGAC
ATCGACATATTGCGGTTGTGTTAGAGGAAATTCCCAAGCTTATGAAAGAAATTTCATCAACAAAGAAAGCAACAGAAGGA
AAGACATCACTTAGTGCTCTTACCCAGCTGATGAAAAAGATGCCCCATTTCCGAAAACAGATTACTAAGCAAGTTGTCCA
TCTTAACTTAGCAGAAGATTGCATGAATAAGTTCAAGCTTAATATAGAAAAGCTCTGCAAAACTGAACAGGACCTCGCAC
TTGGAACTGATGCAGAAGGACAGAAGGTGAAAGATTCCATGCGAGTACTCCTTCCAGTTCTACTCAACAAAAATCATGAT
AATTGTGATAAAATAAGAGCAATTCTACTTTATATCTTCAGTATTAATGGAACTACGGAAGAAAATTTGGACAGGTTGAT
CCAGAATGTAAAGATAGAAAATGAGAGTGACATGATTCGTAACTGGAGTTACCTTGGTGTTCCCATTGTTCCCCAATCTC
AACAAGGCAAACCGTTAAGAAAGGATCGGTCTGCAGAAGAAACTTTTCAGCTCTCTCGGTGGACACCTTTTATCAAAGAT
ATTATGGAGGATGCTATTGATAATAGATTAGATTCAAAAGAATGGCCATATTGTTCCCAGTGTCCAGCAGTATGGAATGG
TTCAGGAGCTGTAAGTGCTCGCCAGAAACCCAGAGCTAATTATTTAGAAGACCGAAAAAATGGGTCAAAGCTGATTGTTT
TTGTAATTGGAGGGATCACATACTCTGAAGTGCGTTGTGCTTATGAAGTTTCTCAGGCACATAAATCCTGTGAAGTTATT
ATTGGTTCTACACATGTTTTAACACCCAAAAAGCTGTTGGATGATATAAAGATGCTGAATAAACCCAAGGATAAAGTCTC
CTTAATTAAAGATGAATAG

Protein (592aa)

>JHU06125
MAPPVAERGLKSVVWQKIKATVFDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNREPVRQMKALYF
ITPTSKSVDCFLHDFASKSENKYRAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISFIPHESQVYTRDVPDAFYYCY
SPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKSLIKGKTHSQLLIIDR
GFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAILEEEDDLWVRIRHRHIAVVLEEIPKLMKEISSTKKATEG
KTSLSALTQLMKKMPHFRKQITKQVVHLNLAEDCMNKFKLNIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHD
NCDKIRAILLYIFSINGTTEENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSAEETFQLSRWTPFIKD
IMEDAIDNRLDSKEWPYCSQCPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGITYSEVRCAYEVSQAHKSCEVI
IGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE