Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06121 SHC4 SHCD Homo sapiens Yes Kinases; Membrane Proteins; Secreted Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
29 8 21 JHU06121
29 8 22 JHU06121
HuProt v3.0
Block Row Column Clone
7 31 31 JHU06121
7 32 31 JHU06121
HuProt v3.1
Block Row Column Clone
7 31 31 JHU06121
7 32 31 JHU06121

External Database ID

Nucleotide (1893bp)

>JHU06121
ATGCGAGAACGCGGCCAGGACAGCCTGGCAGGACTCGTGCTGTATGTAGGACTCTTCGGGCACCCCGGGATGCTGCACAG
GGCCAAGTACAGCCGCTTTCGGAACGAGTCGATCACGTCCTTGGACGAAGGTAGCTCCGGAGGCTCGGTCGGGGACAAGG
GCTCGCCGCAGCCTCCCCACCCCGCCCTGGCACCTCACCTGCCGACTGAAGATGCCACCTTGCCGTCGCAGGAGAGCCCC
ACCCCACTGTGCACCTTGATCCCCCGCATGGCAAGCATGAAGCTGGCCAACCCGGCCACTTTGCTGAGTCTGAAAAACTT
TTGCCTGGGTACCAAAGAGGTGCCTCGGCTGAAGCTCCAGGAAAGCCGGGACCCAGGTTCCAGCGGCCCCTCTTCCCCAG
AAACCAGTTTAAGTAGGTCCGGGACTGCACCTCCACCGCAGCAGGACCTGGTGGGACACAGGGCAACCGCCCTAACCCCT
GATTCGTGCCCGCTTCCTGGCCCTGGGGAGCCAACACTTAGGAGCAGGCAGGACAGGCACTTTCTACAGCACCTGTTGGG
GATGGGCATGAACTACTGTGTGAGGTACATGGGCTGTGTTGAAGTGCTGCAATCAATGAGATCACTGGATTTTGGAATGA
GAACCCAAGTTACAAGGGAAGCAATAAGTCGCCTGTGTGAAGCTGTCCCCGGGGCAAATGGAGCCATTAAAAAGCGAAAG
CCTCCAGTTGAGTTCCTATCAACAGTCCTTGGCAAAAGTAATCTTCAGTTTTCAGGAATGAATATAAAACTGACCATCTC
AACATGCAGTCTCACATTGATGAATCTTGACAACCAACAGATTATTGCAAATCATCATATGCAGTCTATTTCATTTGCCT
CTGGAGGGGATCCTGATACTACAGACTATGTTGCCTACGTAGCTAAAGATCCAGTTAATCAACGAGCCTGTCACATATTG
GAATGCCACAATGGAATGGCCCAAGACGTCATAAGTACCATAGGGCAGGCTTTTGAACTCCGGTTTAAACAGTACTTGAA
AAATCCTTCTTTGAATACTTCTTGTGAAAGTGAGGAGGTGCATATTGATAGCCATGCCGAGGAGAGAGAAGATCATGAAT
ATTACAATGAAATTCCAGGGAAGCAGCCACCAGTAGGTGGTGTTTCAGATATGCGGATCAAAGTTCAAGCCACGGAACAA
ATGGCTTACTGCCCCATACAGTGTGAAAAGTTGTGCTATTTGCCTGGAAACTCCAAGTGCAGCAGTGTATATGAGAACTG
TTTAGAACAAAGCAGGGCAATAGGTAATGTCCATCCAAGAGGGGTGCAGTCCCAGCGAGGTACCTCATTATTGAAGCACA
CGTGCCGAGTGGATCTCTTTGATGACCCCTGCTACATTAATACACAGGCTCTTCAAAGTACACCTGGCTCTGCTGGAAAT
CAAAGGTCAGCCCAACCACTGGGGAGCCCATGGCACTGCGGAAAGGCACCAGAAACTGTTCAGCCGGGTGCCACAGCCCA
GCCTGCCAGCTCACATTCTTTGCCACACATTAAGCAGCAGCTGTGGAGCGAAGAATGCTATCATGGCAAGCTGAGCAGGA
AGGCGGCAGAGAGCCTCTTGGTAAAGGATGGGGACTTTTTGGTTCGAGAGAGTGCAACATCCCCTGGCCAATATGTGCTG
AGTGGACTACAGGGAGGCCAAGCAAAACATCTTCTCCTGGTGGATCCTGAAGGCAAGGTGAGGACCAAGGATCATGTATT
TGATAATGTCGGCCACCTTATCAGATACCATATGGATAACAGTTTGCCAATCATCTCCTCTGGAAGCGAAGTAAGCCTTA
AACAACCAGTGAGAAAAGATAATAATCCAGCACTTTTGCATTCCAACAAATAG

Protein (630aa)

>JHU06121
MRERGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSSGGSVGDKGSPQPPHPALAPHLPTEDATLPSQESP
TPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPPQQDLVGHRATALTP
DSCPLPGPGEPTLRSRQDRHFLQHLLGMGMNYCVRYMGCVEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVEFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNQRACHIL
ECHNGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEVHIDSHAEEREDHEYYNEIPGKQPPVGGVSDMRIKVQATEQ
MAYCPIQCEKLCYLPGNSKCSSVYENCLEQSRAIGNVHPRGVQSQRGTSLLKHTCRVDLFDDPCYINTQALQSTPGSAGN
QRSAQPLGSPWHCGKAPETVQPGATAQPASSHSLPHIKQQLWSEECYHGKLSRKAAESLLVKDGDFLVRESATSPGQYVL
SGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNSLPIISSGSEVSLKQPVRKDNNPALLHSNK