Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06120 PDS5A KIAA0648;PDS5 Homo sapiens Yes Kinases; Nuclear Proteins

HuProt v2.0
Block Row Column Clone
23 8 17 JHU06120
23 8 18 JHU06120
HuProt v3.0
Block Row Column Clone
8 31 18 JHU06120
8 32 18 JHU06120
HuProt v3.1
Block Row Column Clone
8 31 18 JHU06120
8 32 18 JHU06120

External Database ID

Nucleotide (1803bp)

>JHU06120
ATGGACTTCACCGCGCAGCCCAAGCCTGCCACTGCCCTCTGTGGCGTCGTGAGTGCCGACGGGAAGATCGCTTACCCTCC
GGGGGTAAAAGAGATCACCGACAAGATCACCACGGACGAGATGATCAAACGCCTGAAGATGGTAGTGAAAACCTTTATGG
ATATGGATCAGGACTCAGAAGATGAAAAACAGCAGTATCTCCCACTAGCCTTGCATCTTGCATCTGAATTCTTCCTCAGG
AACCCCAATAAAGATGTGCGTCTCCTTGTAGCATGTTGTTTGGCTGATATCTTTCGTATCTATGCCCCAGAAGCTCCATA
TACTTCCCATGATAAACTTAAGGACATATTTTTGTTTATTACCAGACAATTAAAAGGTTTGGAGGATACAAAGAGTCCAC
AGTTTAATAGATACTTTTATTTATTAGAGAATTTAGCTTGGGTTAAATCATATAACATCTGCTTTGAATTGGAAGATTGC
AATGAAATTTTTATTCAGCTTTTTAGAACTCTCTTCTCAGTGATCAACAATAGCCACAATAAGAAGGTACAAATGCACAT
GCTAGATTTGATGAGTTCTATCATCATGGAAGGTGATGGAGTTACTCAAGAATTATTGGACTCCATTCTTATTAACCTCA
TTCCTGCACATAAGAACTTAAATAAACAGTCCTTTGACCTTGCAAAAGTGCTATTGAAAAGAACAGTCCAGACTATTGAG
GCATGCATTGCTAATTTTTTCAATCAAGTCCTGGTGCTGGGAAGATCATCAGTAAGTGATTTGTCAGAACATGTATTTGA
TCTGATTCAGGAACTTTTTGCTATAGATCCTCATTTATTATTATCCGTCATGCCACAGCTTGAATTCAAACTAAAGAGCA
ATGATGGAGAAGAGCGATTAGCTGTTGTTCGACTTCTAGCTAAATTGTTTGGCTCCAAAGATTCTGATTTGGCAACACAG
AATCGTCCTCTTTGGCAATGTTTTCTTGGACGATTTAATGATATTCATGTTCCTGTGAGATTAGAAAGTGTGAAATTTGC
CAGTCATTGTTTAATGAATCACCCAGATTTAGCGAAGGATCTCACAGAATATTTAAAGGTTAGATCACATGATCCAGAAG
AAGCTATTCGTCATGATGTCATTGTTACTATAATAACAGCTGCCAAGAGGGACCTGGCCTTAGTAAATGATCAGCTGCTT
GGCTTTGTAAGGGAAAGAACACTGGATAAACGGTGGCGAGTAAGAAAAGAAGCTATGATGGGTCTGGCTCAGCTTTATAA
GAAATACTGTCTTCATGGTGAAGCAGGAAAGGAAGCTGCAGAGAAAGTCAGCTGGATAAAGGACAAACTTCTGCATATTT
ATTATCAGAACAGCATTGACGACAAACTGTTGGTAGAGAAAATCTTTGCTCAGTATCTTGTCCCCCACAACCTGGAAACA
GAAGAGAGAATGAAATGCTTATATTACTTATATGCTAGTTTGGATCCAAATGCTGTAAAAGCTCTCAACGAAATGTGGAA
GTGTCAGAACATGCTTCGGAGCCATGTACGCGAACTATTGGATTTGCACAAGCAGCCTACATCAGAGGCTAACTGTTCTG
CCATGTTTGGAAAACTGATGACCATAGCAAAGAATTTGCCTGACCCCGGGAAAGCACAAGATTTTGTGAAGAAATTTAAC
CAGGTTCTCGGCGATGATGAGAAACTTCGGTCTCAGTTGGAGTTATTAATTAGCCCAACCTGTTCTTGCAAACAAGCAGA
TATTTGTGTGGTTAGTAAATCATACTTCACACTTTTTCTCTAG

Protein (600aa)

>JHU06120
MDFTAQPKPATALCGVVSADGKIAYPPGVKEITDKITTDEMIKRLKMVVKTFMDMDQDSEDEKQQYLPLALHLASEFFLR
NPNKDVRLLVACCLADIFRIYAPEAPYTSHDKLKDIFLFITRQLKGLEDTKSPQFNRYFYLLENLAWVKSYNICFELEDC
NEIFIQLFRTLFSVINNSHNKKVQMHMLDLMSSIIMEGDGVTQELLDSILINLIPAHKNLNKQSFDLAKVLLKRTVQTIE
ACIANFFNQVLVLGRSSVSDLSEHVFDLIQELFAIDPHLLLSVMPQLEFKLKSNDGEERLAVVRLLAKLFGSKDSDLATQ
NRPLWQCFLGRFNDIHVPVRLESVKFASHCLMNHPDLAKDLTEYLKVRSHDPEEAIRHDVIVTIITAAKRDLALVNDQLL
GFVRERTLDKRWRVRKEAMMGLAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDDKLLVEKIFAQYLVPHNLET
EERMKCLYYLYASLDPNAVKALNEMWKCQNMLRSHVRELLDLHKQPTSEANCSAMFGKLMTIAKNLPDPGKAQDFVKKFN
QVLGDDEKLRSQLELLISPTCSCKQADICVVSKSYFTLFL