Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06105 MPP7 Homo sapiens Yes Kinases; Signal Transduction

HuProt v2.0
Block Row Column Clone
5 8 21 JHU06105
5 8 22 JHU06105
HuProt v3.0
Block Row Column Clone
7 31 7 JHU06105
7 32 7 JHU06105
HuProt v3.1
Block Row Column Clone
7 31 7 JHU06105
7 32 7 JHU06105

External Database ID

Nucleotide (1731bp)

>JHU06105
ATGCCAGCTTTGTCAACGGGATCTGGGAGTGACACTGGTCTGTATGAGCTGTTGGCTGCTCTGCCAGCCCAGCTGCAGCC
ACATGTGGATAGCCAGGAAGACCTGACCTTCCTCTGGGATATGTTTGGTGAAAAAAGCCTGCATTCATTGGTAAAGATTC
ATGAAAAACTACACTACTATGAGAAGCAGAGTCCGGTGCCCATTCTCCATGGTGCGGCGGCCTTGGCCGATGATCTGGCC
GAAGAGCTTCAGAACAAGCCATTAAACAGTGAGATCAGAGAGCTGTTGAAACTACTGTCAAAACCCAATGTGAAGGCTTT
GCTCTCTGTACATGATACTGTGGCTCAGAAGAATTACGACCCAGTGTTGCCTCCTATGCCTGAAGATATTGACGATGAGG
AAGACTCAGTAAAAATAATCCGTCTGGTCAAAAATAGAGAACCACTGGGAGCTACCATTAAGAAGGATGAACAGACCGGG
GCGATCATTGTGGCCAGAATCATGAGAGGAGGAGCTGCAGATAGAAGTGGTCTTATTCATGTTGGTGATGAACTTAGGGA
AGTCAACGGGATACCAGTGGAGGATAAAAGGCCTGAGGAAATAATACAGATTTTGGCTCAGTCTCAGGGAGCAATTACAT
TTAAGATTATACCCGGCAGCAAAGAGGAGACACCATCAAAAGAAGGCAAGATGTTTATCAAAGCCCTCTTTGACTATAAT
CCTAATGAGGATAAGGCAATTCCATGTAAGGAAGCTGGGCTTTCTTTCAAAAAGGGAGATATTCTTCAGATTATGAGCCA
AGATGATGCAACTTGGTGGCAAGCGAAACACGAAGCTGATGCCAACCCCAGGGCAGGCTTGATCCCCTCAAAGCATTTCC
AGGAAAGGAGATTGGCTTTGAGACGACCAGAAATATTGGTTCAGCCCCTGAAAGTTTCCAACAGGAAATCATCTGGTTTT
AGAAGAAGTTTTCGTCTTAGTAGAAAAGATAAGAAAACAAATAAATCCATGTATGAATGCAAGAAGAGTGATCAGTACGA
CACAGCTGACGTACCCACATACGAAGAAGTGACACCGTATCGGCGACAAACTAATGAAAAATACAGACTCGTTGTCTTGG
TTGGTCCCGTGGGAGTAGGGCTGAATGAACTGAAACGAAAGCTGCTGATCAGTGACACACAGCACTATGGCGTGACAGTG
CCCCATACCACCAGAGCAAGAAGAAGCCAGGAGAGTGATGGTGTTGAATACATTTTCATTTCCAAGCATTTGTTTGAGAC
AGATGTACAAAATAACAAGTTTATTGAATATGGAGAATATAAAAACAACTACTACGGCACAAGTATAGACTCAGTTCGGT
CTGTCCTTGCTAAAAACAAAGTTTGTTTGTTGGATGTTCAGCCTCATACAGTGAAGCATTTAAGGACACTAGAATTTAAG
CCCTATGTGATATTTATAAAGCCTCCATCAATAGAGCGTTTGAGAGAAACAAGAAAAAATGCAAAGATTATTTCAAGCAG
AGATGACCAAGGTGCTGCAAAACCCTTCACAGAAGAAGATTTTCAAGAAATGATTAAATCTGCACAGATAATGGAAAGTC
AATATGGTCATCTTTTTGACAAAATTATAATAAATGATGACCTCACTGTGGCATTTAATGAGCTCAAAACAACTTTTGAC
AAATTAGAGACAGAGACCCATTGGGTGCCAGTGAGCTGGTTACATTCATAG

Protein (576aa)

>JHU06105
MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSLVKIHEKLHYYEKQSPVPILHGAAALADDLA
EELQNKPLNSEIRELLKLLSKPNVKALLSVHDTVAQKNYDPVLPPMPEDIDDEEDSVKIIRLVKNREPLGATIKKDEQTG
AIIVARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIQILAQSQGAITFKIIPGSKEETPSKEGKMFIKALFDYN
PNEDKAIPCKEAGLSFKKGDILQIMSQDDATWWQAKHEADANPRAGLIPSKHFQERRLALRRPEILVQPLKVSNRKSSGF
RRSFRLSRKDKKTNKSMYECKKSDQYDTADVPTYEEVTPYRRQTNEKYRLVVLVGPVGVGLNELKRKLLISDTQHYGVTV
PHTTRARRSQESDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQPHTVKHLRTLEFK
PYVIFIKPPSIERLRETRKNAKIISSRDDQGAAKPFTEEDFQEMIKSAQIMESQYGHLFDKIIINDDLTVAFNELKTTFD
KLETETHWVPVSWLHS