Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06102 LTA4H LTA4 Homo sapiens Yes Metabolism

HuProt v2.0
Block Row Column Clone
21 8 25 JHU06102
21 8 26 JHU06102
HuProt v3.0
Block Row Column Clone
6 31 21 JHU06102
6 32 21 JHU06102
HuProt v3.1
Block Row Column Clone
6 31 21 JHU06102
6 32 21 JHU06102

External Database ID

Nucleotide (1836bp)

>JHU06102
ATGCCCGAGATAGTGGATACCTGTTCGTTGGCCTCTCCGGCTTCCGTCTGCCGGACCAAGCACCTGCACCTGCGCTGCAG
CGTCGACTTTACTCGCCGGACGCTGACCGGGACTGCTGCTCTCACGGTCCAGTCTCAGGAGGACAATCTGCGCAGCCTGG
TTTTGGATACAAAGGACCTTACAATAGAAAAAGTAGTGATCAATGGACAAGAAGTCAAATATGCTCTTGGAGAAAGACAA
AGTTACAAGGGATCGCCAATGGAAATCTCTCTTCCTATCGCTTTGAGCAAAAATCAAGAAATTGTTATAGAAATTTCTTT
TGAGACCTCTCCAAAATCTTCTGCTCTCCAGTGGCTCACTCCTGAACAGACTTCTGGGAAGGAACACCCATATCTCTTTA
GTCAGTGCCAGGCCATCCACTGCAGAGCAATCCTTCCTTGTCAGGACACTCCTTCTGTGAAATTAACCTATACTGCAGAG
GTGTCTGTCCCTAAAGAACTGGTGGCACTTATGAGTGCTATTCGTGATGGAGAAACACCTGACCCAGAAGACCCAAGCAG
GAAAATATACAAATTCATCCAAAAAGTTCCAATACCCTGCTACCTGATTGCTTTAGTTGTTGGAGCTTTAGAAAGCAGGC
AAATTGGCCCAAGAACTTTGGTGTGGTCTGAGAAAGAGCAGGTGGAAAAGTCTGCTTATGAGTTTTCTGAGACTGAATCT
ATGCTTAAAATAGCAGAAGATCTGGGAGGACCGTATGTATGGGGACAGTATGACCTATTGGTCCTGCCACCATCCTTCCC
TTATGGTGGCATGGAGAATCCTTGCCTTACTTTTGTAACTCCTACTCTACTGGCAGGCGACAAGTCACTCTCCAATGTCA
TTGCACATGAAATATCTCATAGCTGGACAGGGAATCTAGTGACCAACAAAACTTGGGATCACTTTTGGTTAAATGAGGGA
CATACTGTGTACTTGGAACGCCACATTTGCGGACGATTGTTTGGTGAAAAGTTCAGACATTTTAATGCTCTGGGAGGATG
GGGAGAACTACAGAATTCGGTAAAGACATTTGGGGAGACACATCCTTTCACCAAACTTGTGGTTGATCTGACAGATATAG
ACCCTGATGTAGCTTATTCTTCAGTTCCCTATGAGAAGGGCTTTGCTTTACTTTTTTACCTTGAACAACTGCTTGGAGGA
CCAGAGATTTTCCTAGGATTCTTAAAAGCTTATGTTGAGAAGTTTTCCTATAAGAGCATAACTACTGATGACTGGAAGGA
TTTCCTGTATTCCTATTTTAAAGATAAGGTTGATGTTCTCAATCAAGTTGATTGGAATGCCTGGCTCTACTCTCCTGGAC
TGCCTCCCATAAAGCCCAATTATGATATGACTCTGACAAATGCTTGTATTGCCTTAAGTCAAAGATGGATTACTGCCAAA
GAAGATGATTTAAATTCATTCAATGCCACAGACCTGAAGGATCTCTCTTCTCATCAATTGAATGAGTTTTTAGCACAGAC
GCTCCAGAGGGCACCTCTTCCATTGGGGCACATAAAGCGAATGCAAGAGGTGTACAACTTCAATGCCATTAACAATTCTG
AAATACGATTCAGATGGCTGCGGCTCTGCATTCAATCCAAGTGGGAGGACGCAATTCCTTTGGCGCTAAAGATGGCAACT
GAACAAGGAAGAATGAAGTTTACCCGGCCCTTATTCAAGGATCTTGCTGCCTTTGACAAATCCCATGATCAAGCTGTCCG
AACCTACCAAGAGCACAAAGCAAGCATGCATCCCGTGACTGCAATGCTGGTGGGGAAAGACTTAAAAGTGGATTAG

Protein (611aa)

>JHU06102
MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQ
SYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAE
VSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEG
HTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGG
PEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAK
EDDLNSFNATDLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMAT
EQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVTAMLVGKDLKVD