Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00061 CDK16 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
42 1 1 JHU00061
42 1 2 JHU00061
39 24 25 JHU00061
39 24 26 JHU00061
HuProt v3.0
Block Row Column Clone
4 3 15 JHU00061
4 4 15 JHU00061
18 45 10 JHU00061
18 46 10 JHU00061
HuProt v3.1
Block Row Column Clone
4 3 15 JHU00061
4 4 15 JHU00061
18 45 10 JHU00061
18 46 10 JHU00061

External Database ID

Nucleotide (1347bp)

>JHU00061
ATGGATCGGATGAAGAAGATCAAACGGCAGCTGTCAATGACACTCAGCTCTGCACCAGAGATTGTGCACGAGGACTTGAA
GATGGGGTCTGATGGGGAGAGTGACCAGGCTTCAGCCACGTCCTCGGATGAGGTGCAGTCTCCAGTGAGAGTGCGTATGC
GCAACCATCCCCCACGCAAGATCTCCACTGAGGACATCAACAAGCGCCTATCACTACCAGCTGACATCCGGCTGCCTGAG
GGCTACCTGGAGAAGCTGACCCTCAATAGCCCCATCTTTGACAAGCCCCTCAGCCGCCGCCTCCGTCGTGTCAGCCTATC
TGAGATTGGCTTTGGGAAACTGGAGACCTACATTAAGCTGGACAAACTGGGCGAGGGTACCTATGCCACCGTCTACAAAG
GCAAAAGCAAGCTCACAGACAACCTTGTGGCACTCAAGGAGATCAGACTGGAACATGAAGAGGGGGCACCCTGCACCGCC
ATCCGGGAAGTGTCCCTGCTCAAGGACCTCAAACACGCCAACATCGTTACGCTACATGACATTATCCACACGGAGAAGTC
CCTCACCCTTGTCTTTGAGTACCTGGACAAGGACCTGAAGCAGTACCTGGATGACTGTGGGAACATCATCAACATGCACA
ACGTGAAACTGTTCCTGTTCCAGCTGCTCCGTGGCCTGGCCTACTGCCACCGGCAGAAGGTGCTACACCGAGACCTCAAG
CCCCAGAACCTGCTCATCAACGAGAGGGGAGAGCTCAAGCTGGCTGACTTTGGCCTGGCCCGAGCCAAGTCAATCCCAAC
AAAGACATACTCCAATGAGGTGGTGACACTGTGGTACCGGCCCCCTGACATCCTGCTTGGGTCCACGGACTACTCCACTC
AGATTGACATGTGGGGTGTGGGCTGCATCTTCTATGAGATGGCCACAGGCCGTCCCCTCTTTCCGGGCTCCACGGTGGAG
GAACAGCTACACTTCATCTTCCGTATCTTAGGAACCCCAACTGAGGAGACGTGGCCAGGCATCCTGTCCAACGAGGAGTT
CAAGACATACAACTACCCCAAGTACCGAGCCGAGGCCCTTTTGAGCCACGCACCCCGACTTGATAGCGACGGGGCCGACC
TCCTCACCAAGCTGTTGCAGTTTGAGGGTCGAAATCGGATCTCCGCAGAGGATGCCATGAAACATCCATTCTTCCTCAGT
CTGGGGGAGCGGATCCACAAACTTCCTGACACTACTTCCATATTTGCACTAAAGGAGATTCAGCTACAAAAGGAGGCCAG
CCTTCGGTCTTCGTCGATGCCTGACTCAGGCAGGCCAGCTTTCCGCGTGGTGGACACCGAGTTCTAG

Protein (448aa)

>JHU00061
MDRMKKIKRQLSMTLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPADIRLPE
GYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTA
IREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLK
PQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVE
EQLHFIFRILGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRLDSDGADLLTKLLQFEGRNRISAEDAMKHPFFLS
LGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFRVVDTEF