Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06080 FAM71A Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
13 8 25 JHU06080
13 8 26 JHU06080
HuProt v3.0
Block Row Column Clone
6 31 13 JHU06080
6 32 13 JHU06080
HuProt v3.1
Block Row Column Clone
6 31 13 JHU06080
6 32 13 JHU06080

External Database ID

Nucleotide (1785bp)

>JHU06080
ATGAATGCTGATTTTCTGCTGCCGTATTATACGGCCCAGAGTGGCTCCAGCATGAGCATGTTCGACACCACCATGGGGAA
ACTGCAGCGACAACTGTACAAGGGGGAGTACGATATATTCAAGTATGCACCGATATTTGAGAGCGACTTTATCCAGATCA
CCAAAAGGGGAGAAGTGATTGATGTGCACAACCGTGTCCGTATGGTGACCATGGGCATTGCACGTACCAGCCCCATCCTC
CCACTCCCAGATGTCATGCTACTGGCACGACCGGCCACCGGCTGCGAAGAGTATGCTGGACATGGCCAGGCCACCAAGAG
AAAAAAACGCAAGGCAGCAAAGAACTTAGAGCTCACCAGGCTTCTGCCCCTGAGGTTTGTACGGATCTCTGTTCAAGACC
ATGAGAAACAACAGCTGCGCCTGAAGTTCGCCACTGGCAGATCTTGCTATCTGCAATTGTGTCCCGCTCTTGACACACGG
GATGACCTCTTTGCCTATTGGGAAAAACTAATTTACCTCTTGCGGCCACCCATGGAGAGTAACAGCAGTACCTGTGGCAT
TCCAGCTGAAGACATGATGTGGATGCCTGTGTTTCAGGAAGACAGGAGGAGCCTGGGAGCCGTGAACCTTCAAGGAAAGG
GGGATCAGGACCAGGTCAGCATCCAAAGCCTCCACATGGTCTCTGAGGTGTGTGGGGCCACCTCTGCTGCTTATGCTGGA
GGGGAGGGACTCCAAAATGACTTTAACAAACCCACTAATGTGCTCAATGCATCCATCCCCAAAACATCTACAGAACTTGC
TGAGGAGCCAGCAACAGGGGGGATTAAAGAGGCAGCAGCAGCAGGGGCAGCTGCAGGGGCAGCAACAGGCACCGTAGCAG
GTGCCTTGAGTGTGGCAGCAGCCAATTCTGCCCCTGGACAGGTGAGCGCAGCCATAGCTGGGGCGGCCACCATCGATGCA
GGAGGAAACAAAGGCAACATGGCCCTTGCAGGCACTGCCAGCATGGCTCCAAACAGCACGAAGGTGGCTGTGGCAGGGGC
TGCAGGCAAGTCCTCAGAGCATGTTTCCAGCGCATCCATGAGCCTTTCCCGAGAGGGCAGTGTGAGCCTGGCCATTGCAG
GAGTAGTACTGACCAGCAGGACAGCTGCAGAAGCAGACATGGATGCAGCAGCGGGACCTCCCGTCTCCACCCGGCAGAGC
AAGAGCAGCCTGAGTGGACAGCATGGAAGGGAGCGAACCCAGGCCAGCGCTGAAGGCTGCAAGGAGGGGAGGGAAAGAAG
GGAAAAGGACAGGGCTCTCGGAAGGAGTTCCCATCGCCGCAGGACAGGTGAAAGCCGCCACAAAACAAGGGGAGACAAGA
TTGCCCAAAAGTCCTCCAGCAGGTCCTCATTCAGCCACAGAGCCAATAGAGATGACAAAAAGGAGAAAGGCTGTGGCAAC
CCGGGGAGCAGCAGGCACAGGGACTCGCATAAAGGTGTCAGCCACACGCCCATCTCAAAGGAGTCCAGGACCTCTCACAA
ATCTGGGAGGAGCTTATGGACCACCAGTTCCGGTTCCAGCAAGGGACTTGGCAGGGTCAGCTCTTTCCTGAGGAACGTCA
GAGCCAACCTTACTACAAAAGTAGTGGGCACACCACATGGCAGAGATGTGGACGTCATGGCTAAGATGGCGGAGAGGAGC
ACCAACGTGGCCATCGCCGAGACAGCAGAGGGTGGCCAGGGGCTGGAGATGGTTGGTTCTATGACACCGGACATCATGGA
GACAGTGACCTTTGAAGCCCATTAG

Protein (594aa)

>JHU06080
MNADFLLPYYTAQSGSSMSMFDTTMGKLQRQLYKGEYDIFKYAPIFESDFIQITKRGEVIDVHNRVRMVTMGIARTSPIL
PLPDVMLLARPATGCEEYAGHGQATKRKKRKAAKNLELTRLLPLRFVRISVQDHEKQQLRLKFATGRSCYLQLCPALDTR
DDLFAYWEKLIYLLRPPMESNSSTCGIPAEDMMWMPVFQEDRRSLGAVNLQGKGDQDQVSIQSLHMVSEVCGATSAAYAG
GEGLQNDFNKPTNVLNASIPKTSTELAEEPATGGIKEAAAAGAAAGAATGTVAGALSVAAANSAPGQVSAAIAGAATIDA
GGNKGNMALAGTASMAPNSTKVAVAGAAGKSSEHVSSASMSLSREGSVSLAIAGVVLTSRTAAEADMDAAAGPPVSTRQS
KSSLSGQHGRERTQASAEGCKEGRERREKDRALGRSSHRRRTGESRHKTRGDKIAQKSSSRSSFSHRANRDDKKEKGCGN
PGSSRHRDSHKGVSHTPISKESRTSHKSGRSLWTTSSGSSKGLGRVSSFLRNVRANLTTKVVGTPHGRDVDVMAKMAERS
TNVAIAETAEGGQGLEMVGSMTPDIMETVTFEAH