Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06079 ENTHD1 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
21 8 21 JHU06079
21 8 22 JHU06079
HuProt v3.0
Block Row Column Clone
7 31 21 JHU06079
7 32 21 JHU06079
HuProt v3.1
Block Row Column Clone
7 31 21 JHU06079
7 32 21 JHU06079

External Database ID

Nucleotide (1824bp)

>JHU06079
ATGGCGTTCAGGAGACAAGTGAAAAACTTTGTGAAAAATTACTCAGATGCTGAAATAAAAGTCAGGGAAGCAACTTCTAA
CGACCCTTGGGGTCCCTCTAGTTCTCTGATGTTAGATATCAGTGACTTGACTTTCAACACAATTTCTCTCTCAGAGATTA
TGAATATGCTGTGGCACAGACTCAATGACCATGGGAAGAACTGGCGCCACGTGTATAAATCCCTTACCCTAATGGATTAT
CTCATCAAGAATGGATCAAAGAAAGTTATTCAGCATTGCAGAGAGGGGTTCTGTAACCTTCAAACACTAAAAGATTTTCA
GCACATAGATGAAGCTGGAAAAGACCAAGGTTATTATATCCGGGAAAAATCTAAGCAAGTCATCACATTGCTGATGGATG
AACCATTGCTGTGTAAAGAGAGGGAAGTGGCATGTCGGACTAGACAGCGTACCTCCCACTCTATATTGTTTTCTAAAAGA
CAACTTGGTTCAAGTAACTCACTGACAGCGTGCACTTCTGCCCCCACACCGGATATTTCTGCTTCAGAGAAGAAGTATAA
GCTTCCTAAGTTTGGAAGGTTACATAATAAAAGAAATGTGTGCAAGGCAGGATTGAAACAAGAGCATTGCCAAGATGTTC
ATTTGCCTACAGAAACTATGTTGTCCCAGGAAACACTTCCACTCAAGATTCATGGTTGGAAATCAACAGAGGACCTGATG
ACATTTTTGGATGATGATCCAGAGCTGCCTTTACTAGCAACACCTCCTTCCATTGTCTCTCCAATCACTTGCTTGTCAGA
AGCAGAAGAAGTTTGTAATCTTTCGGGTGCAGATGCTGTGCCTACTCTCTCAGAAAATAGTCCTTCTGGGCAGAGAGATG
TGAGTTTGGACAAGAGATCAGATGGTATCTTTACAAATACTGTCACAGAAAACCTCTTGGAAACACCTTTAGAAAAGCAA
TCAGCTGCAGAAGGTCTTAAAACATTGACAATTTTACCAGCATGTTGGTCAAGTAAAGAGGAGTTTATCAGCCCCGACTT
AAGGGTATCAAAGTCAGATTCTACTTTCCATAACCAGGCCTCTGTAGAAACACTCTGTCTCTCTCCCTCATTCAAAATAT
TTGACCGAGTGAAGGAGATTGTAATCAACAAGGCCTACCAGAAACCAGCACAATCCAGCATTCAGATGGATGATAAAATC
CTCAAGACAACCACACGGGTTTCAACTGCTTCTGAGGGAGCATCTTCCTTTTCTCCTTTATCCATGTCATCTCCTGATTT
AGCCTCTCCAGAGAAGTCAGCTCATCTCTTATCACCAATTCTGGCCGGACCTTCCTTCTGGACTCTGTCCCATCAACAGT
TGTCTTCTACCTCCTTTAAAGATGAAGATAAGACAGCCAAGCTGCATCACTCCTTTGCTTCTAGGGGCCCAGTGTCTTCT
GATGTAGAGGAAAATGATAGCCTCAATCTACTGGGAATTCTTCCAAATAACTCTGATTCTGCTAAAAAGAATATAAGTCA
CATTTCTAGTAGTCACTGGGGGGAGTTTTCCACCCAAAATGTAGACCAGTTCATCCCTCTGTCCTGTTCTGGTTTTCAGT
CAACCAAAGACTTCCCCCAGGAACCTGAAGCAAAGAATTCCATTAGTGTTCTTTTAAGGGAGGTAAAACGTGCGATCGCT
AGATTACATGAAGATCTGAGCACAGTGATCCAAGAACTTAATGTCATCAATAACATCTTGATGAGCATGAGTCTGAATAG
TTCACAAATAAGCCAGTCTTCCCAGGTCCCCCAGTCTTCTGAGGGGAGCTCAGATCAGATCTAG

Protein (607aa)

>JHU06079
MAFRRQVKNFVKNYSDAEIKVREATSNDPWGPSSSLMLDISDLTFNTISLSEIMNMLWHRLNDHGKNWRHVYKSLTLMDY
LIKNGSKKVIQHCREGFCNLQTLKDFQHIDEAGKDQGYYIREKSKQVITLLMDEPLLCKEREVACRTRQRTSHSILFSKR
QLGSSNSLTACTSAPTPDISASEKKYKLPKFGRLHNKRNVCKAGLKQEHCQDVHLPTETMLSQETLPLKIHGWKSTEDLM
TFLDDDPELPLLATPPSIVSPITCLSEAEEVCNLSGADAVPTLSENSPSGQRDVSLDKRSDGIFTNTVTENLLETPLEKQ
SAAEGLKTLTILPACWSSKEEFISPDLRVSKSDSTFHNQASVETLCLSPSFKIFDRVKEIVINKAYQKPAQSSIQMDDKI
LKTTTRVSTASEGASSFSPLSMSSPDLASPEKSAHLLSPILAGPSFWTLSHQQLSSTSFKDEDKTAKLHHSFASRGPVSS
DVEENDSLNLLGILPNNSDSAKKNISHISSSHWGEFSTQNVDQFIPLSCSGFQSTKDFPQEPEAKNSISVLLREVKRAIA
RLHEDLSTVIQELNVINNILMSMSLNSSQISQSSQVPQSSEGSSDQI