Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06059 METTL25 C12orf26 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
21 8 17 JHU06059
21 8 18 JHU06059
HuProt v3.0
Block Row Column Clone
8 31 21 JHU06059
8 32 21 JHU06059
HuProt v3.1
Block Row Column Clone
8 31 21 JHU06059
8 32 21 JHU06059

External Database ID

Nucleotide (1812bp)

>JHU06059
ATGGCGGCTTCTTGCCCTCTCCCGGTGACCCCGGACCTGCCCACGCTGCGTGCCAAGTTGCAGGGACTGCTGCAGTTCCT
GAGGGATGCCCTGTCCATTTCCAATGCACATACCGTGGATTTCTACACAGAATCCGTGTGGGAGGAGCTGGTCGACTTGC
CACCGGAGACAGTGCTGGCTGCGCTGAGGAAGTCAGCGTCGGAGACGGAGGCCCTGCCCTCAGAGACGCGCCCCCTAGTG
GAAGCAGAGTGGGAAGCAGGTATGACTGATTTTCCCAAAATATTTTGTGAAACTTCTCAGAAGTTGGTGAGTGTGGAAGC
CTTTGCTCTGGCTGCGAAATACTATTCTGTACAAAACTTGGGAATATGTACTCCTTTTGAACAGTTGCTTGTAGCCCTTC
GAGGAAATCAAAACCAGAGAATTGGTGAAAATCAGAAGGCAGTTGAGTTTATGAATATGAAGAAATCTCATGAAGTTCAG
GCAATGTCAGAGCTGATTAGCAGTATTGCTGACTACTATGGAATAAAGCAGGTGATTGACTTGGGTTCCGGTAAAGGCTA
CCTAAGCTCTTTTTTGTCCTTGAAGTATGGCTTAAAAGTTTATGGAATTGATTCTTCAAATACCAATACTCATGGAGCTG
AGGAGAGAAACAGAAAATTGAAGAAACATTGGAAACTCTGTCATGCTCAGTCAAGATTAGATGTCAATGGACTAGCATTA
AAAATGGCAAAAGAAAGGAAAGTGAAAAATAAAGTTAAAAATAAAGCTGATACTGAGGAAGTGTTTAACAACAGTCCTAC
AAATCAAGAAAAGATGCCTACCTCAGCTATTTTGCCTGATTTTTCTGGCTCTGTAATTTCTAATATCAGAAACCAAATGG
AAACCCTTCATTCTCAGCCACATCAAGAAGAAAATTTGTGTTTTGAAAATTCCTTTTCTCTTATAAACCTTTTGCCTATT
AATGCTGTAGAGCCTACTTCTTCACAGCAAATACCCAACAGAGAAACATCTGAAGCCAATAAAGAGAGAAGAAAAATGAC
ATCAAAGTCAAGTGAATCAAATATATATTCACCTTTAACCTCTTTTATCACTGCTGATTCAGAACTCCATGACATTATTA
AAGATTTGGAGGATTGTTTGATGGTGGGTCTCCACACTTGTGGTGATCTGGCTCCAAATACTTTGCGAATATTTACCTCC
AACTCTGAAATCAAGGGAGTTTGCAGTGTGGGTTGTTGCTACCACCTCTTATCTGAAGAATTTGAAAACCAGCATAAAGA
ACGTACTCAGGAAAAGTGGGGATTTCCAATGTGCCACTATTTAAAGGAAGAGAGATGGTGCTGTGGTCGTAATGCCAGAA
TGTCAGCATGTTTGGCATTGGAGCGGGTTGCAGCTGGCCAAGGGCTGCCTACTGAATCACTCTTCTATCGTGCTGTTCTT
CAGGATATTATTAAAGATTGTTATGGCATCACCAAATGTGATCGGCATGTTGGTAAAATTTATTCCAAATGTTCTTCTTT
TCTGGATTATGTCAGACGGTCTCTAAAGAAGCTTGGATTAGATGAGTCCAAGCTGCCAGAAAAAATTATAATGAACTACT
ACGAGAAGTATAAGCCTCGAATGAATGAGCTGGAAGCTTTTAATATGTTGAAAGTTGTACTGGCTCCCTGTATAGAGACT
TTGATTCTTCTGGATCGACTTTGTTACCTGAAAGAGCAGGAAGATATTGCATGGTCTGCTCTTGTGAAGTTGTTTGATCC
CGTGAAATCTCCCAGATGTTATGCTGTTATTGCCCTGAAGAAGCAGCAGTAG

Protein (603aa)

>JHU06059
MAASCPLPVTPDLPTLRAKLQGLLQFLRDALSISNAHTVDFYTESVWEELVDLPPETVLAALRKSASETEALPSETRPLV
EAEWEAGMTDFPKIFCETSQKLVSVEAFALAAKYYSVQNLGICTPFEQLLVALRGNQNQRIGENQKAVEFMNMKKSHEVQ
AMSELISSIADYYGIKQVIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLAL
KMAKERKVKNKVKNKADTEEVFNNSPTNQEKMPTSAILPDFSGSVISNIRNQMETLHSQPHQEENLCFENSFSLINLLPI
NAVEPTSSQQIPNRETSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTS
NSEIKGVCSVGCCYHLLSEEFENQHKERTQEKWGFPMCHYLKEERWCCGRNARMSACLALERVAAGQGLPTESLFYRAVL
QDIIKDCYGITKCDRHVGKIYSKCSSFLDYVRRSLKKLGLDESKLPEKIIMNYYEKYKPRMNELEAFNMLKVVLAPCIET
LILLDRLCYLKEQEDIAWSALVKLFDPVKSPRCYAVIALKKQQ