Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06043 WFDC2 HE4;WAP5 Homo sapiens Yes Secreted Proteins

HuProt v2.0
Block Row Column Clone
1 8 29 JHU06043
1 8 30 JHU06043
HuProt v3.0
Block Row Column Clone
5 31 1 JHU06043
5 32 1 JHU06043
HuProt v3.1
Block Row Column Clone
5 31 1 JHU06043
5 32 1 JHU06043

External Database ID

Nucleotide (375bp)

>JHU06043
ATGCCTGCTTGTCGCCTAGGCCCGCTAGCCGCCGCCCTCCTCCTCAGCCTGCTGCTGTTCGGCTTCACCCTAGTCTCAGG
CACAGGAGCAGAGAAGACTGGCGTGTGCCCCGAGCTCCAGGCTGACCAGAACTGCACGCAAGAGTGCGTCTCGGACAGCG
AATGCGCCGACAACCTCAAGTGCTGCAGCGCGGGCTGTGCCACCTTCTGCTCTCTGCCCAATGATAAGGAGGGTTCCTGC
CCCCAGGTGAACATTAACTTTCCCCAGCTCGGCCTCTGTCGGGACCAGTGCCAGGTGGACAGCCAGTGTCCTGGCCAGAT
GAAATGCTGCCGCAATGGCTGTGGGAAGGTGTCCTGTGTCACTCCCAATTTCTAG

Protein (124aa)

>JHU06043
MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSC
PQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF