Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06042 KJ903373_frag Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
1 8 17 JHU06042
1 8 18 JHU06042
HuProt v3.0
Block Row Column Clone
8 31 1 JHU06042
8 32 1 JHU06042
HuProt v3.1
Block Row Column Clone
8 31 1 JHU06042
8 32 1 JHU06042

Nucleotide (339bp)

>JHU06042
ATGTTCCGCTGGGAGCGCTCCATTCCCCTGCGAGGCTCGGCCGCCGCCCTGTGCAACAACCTCAGTGTGCTGCAGCTGCC
GGCTCGCAACCTCACGTATTTTGGCGTGGTTCATGGACCAAGCGCCCAGCTTCTCAGCGCTGCTCCTGAGGGTGTGCCCT
TGGCCCAGCGCCAGCTCCACGCTAAGGAGGGTGCTGGAGTGAGTCCCCCACTTATCACTCAGGTGAGGCATGGAGCTGGG
AGTGATGTTGCTGAACCCAGTCCTACCCCCAGCCTTTTCTCTCCAAACCTTCAGGAGCAGGCATGTCCTAACCTCAGAAT
CTCCCCAGGCATGTCCTAG

Protein (112aa)

>JHU06042
MFRWERSIPLRGSAAALCNNLSVLQLPARNLTYFGVVHGPSAQLLSAAPEGVPLAQRQLHAKEGAGVSPPLITQVRHGAG
SDVAEPSPTPSLFSPNLQEQACPNLRISPGMS