Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06024 BC041668.1_frag Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
27 8 29 JHU06024
27 8 30 JHU06024
HuProt v3.0
Block Row Column Clone
5 31 24 JHU06024
5 32 24 JHU06024
HuProt v3.1
Block Row Column Clone
5 31 24 JHU06024
5 32 24 JHU06024

Nucleotide (522bp)

>JHU06024
ATGTCGTGCGTCAAGTTATGGCCCAGCGGTGCCCCCGCCCCCTTGGTGTCCATCGAGGAACTGGAGAACCAGGAGCTCGT
CGGCAAAGGCGGGTTCGGCACAGTGTTCCGGGCGCAACATAGGAAGTGGGGCTACGATGTGGCGGTCAAGATCGTAAACT
CGAAGGCGATATCCAGGGAGGTCAAGGCCATGGCAAGTCTGGATAACGAATTCGTGCTGCGCCTAGAAGGGGTTATCGAG
AAGGTGAACTGGGACCAAGATCCCAAGCCGGCTCTGGTGACTAAATTCATGGAGAACGGCTCCTTGTCGGGGCTGCTGCA
GTCCCAGTGCCCTCGGCCCTGGCCGCTCCTTTGCCGCCTGCTGAAAGAAGTGGTGCTTGGGATGTTTTACCTGCACCGGG
ACCTCAAGCCATCCAACGTCCTGCTGGACCCAGAGCTGCACGTCAAGGTCAGCTGGTCTACACCCCTCTCAGCCTCAAGA
CAAGGCCCCAGAGCTGCTCCAGCCAGGCCCGCCGGACACTAG

Protein (173aa)

>JHU06024
MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNEFVLRLEGVIE
KVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRLLKEVVLGMFYLHRDLKPSNVLLDPELHVKVSWSTPLSASR
QGPRAAPARPAGH