Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06015 PFDN6 HKE2;PFD6 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
11 8 21 JHU06015
11 8 22 JHU06015
HuProt v3.0
Block Row Column Clone
7 31 16 JHU06015
7 32 16 JHU06015
HuProt v3.1
Block Row Column Clone
7 31 16 JHU06015
7 32 16 JHU06015

External Database ID

Nucleotide (390bp)

>JHU06015
ATGGCGGAGCTGATCCAGAAGAAGCTACAGGGAGAAGTGGAGAAATATCAACAGCTACAGAAGGACTTAAGTAAATCCAT
GTCGGGGAGGCAGAAACTTGAAGCACAACTAACAGAAAATAATATCGTGAAAGAGGAACTGGCCCTGCTGGATGGGTCCA
ACGTGGTCTTTAAACTTCTGGGTCCGGTGCTAGTCAAACAGGAGCTGGGGGAGGCTCGGGCCACAGTAGGGAAGAGGCTG
GACTATATCACAGCTGAAATTAAGCGATACGAATCCCAGCTTCGGGATCTTGAGCGGCAGTCAGAGCAACAGAGGGAGAC
CCTTGCTCAGCTGCAGCAGGAGTTCCAGCGGGCCCAGGCAGCAAAGGCAGGGGCTCCTGGCAAGGCCTAG

Protein (129aa)

>JHU06015
MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELGEARATVGKRL
DYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA