Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU06010 MTFP1 MTP18 Homo sapiens Yes Cell Death; Kinases

HuProt v2.0
Block Row Column Clone
27 8 21 JHU06010
27 8 22 JHU06010
HuProt v3.0
Block Row Column Clone
7 31 24 JHU06010
7 32 24 JHU06010
HuProt v3.1
Block Row Column Clone
7 31 24 JHU06010
7 32 24 JHU06010

External Database ID

Nucleotide (501bp)

>JHU06010
ATGTCAGAGCCGCAGCCGCGGGGCGCAGAGCGCGATCTCTACCGGGACACGTGGGTGCGATACCTGGGCTATGCCAATGA
GGTGGGCGAGGCTTTCCGCTCTCTTGTGCCAGCGGCGGTGGTGTGGCTGAGCTATGGCGTGGCCAGCTCCTACGTGCTGG
CGGATGCCATTGACAAAGGCAAGAAGGCTGGAGAGGTGCCCAGCCCTGAAGCAGGCCGCAGCGCCAGGGTGACTGTGGCT
GTGGTGGACACCTTTGTATGGCAGGCTCTAGCCTCTGTGGCCATTCCGGGCTTCACCATCAACCGCGTGTGTGCTGCCTC
TCTCTATGTCCTGGGCACTGCCACCCGCTGGCCCCTGGCTGTCCGCAAGTGGACCACCACCGCGCTTGGGCTGTTGACCA
TCCCCATCATTATCCACCCCATTGACAGGTCGGTGGATTTCCTCCTGGACTCCAGCCTGCGCAAGCTCTACCCAACAGTG
GGGAAGCCCAGCTCCTCCTAG

Protein (166aa)

>JHU06010
MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVA
VVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTV
GKPSSS