Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00006 AK3 AK3L1;AK6;AKL3L Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
26 1 15 JHU00006
26 1 16 JHU00006
HuProt v3.0
Block Row Column Clone
1 5 15 JHU00006
1 6 15 JHU00006
HuProt v3.1
Block Row Column Clone
1 5 15 JHU00006
1 6 15 JHU00006

External Database ID

Nucleotide (684bp)

>JHU00006
ATGGGGGCGTCCGCGCGGCTGCTGCGAGCGGTGATCATGGGGGCCCCGGGCTCGGGCAAGGGCACCGTGTCGTCGCGCAT
CACTACACACTTCGAGCTGAAGCACCTCTCCAGCGGGGACCTGCTCCGGGACAACATGCTGCGGGGCACAGAAATTGGCG
TGTTAGCCAAGGCTTTCATTGACCAAGGGAAACTCATCCCAGATGATGTCATGACTCGGCTGGCCCTTCATGAGCTGAAA
AATCTCACCCAGTATAGCTGGCTGTTGGATGGTTTTCCAAGGACACTTCCACAGGCAGAAGCCCTAGATAGAGCTTATCA
GATCGACACAGTGATTAACCTGAATGTGCCCTTTGAGGTCATTAAACAACGCCTTACTGCTCGCTGGATTCATCCCGCCA
GTGGCCGAGTCTATAACATTGAATTCAACCCTCCCAAAACTGTGGGCATTGATGACCTGACTGGGGAGCCTCTCATTCAG
CGTGAGGATGATAAACCAGAGACGGTTATCAAGAGACTAAAGGCTTATGAAGACCAAACAAAGCCAGTCCTGGAATATTA
CCAGAAAAAAGGGGTGCTGGAAACATTCTCCGGAACAGAAACCAACAAGATTTGGCCCTATGTATATGCTTTCCTACAAA
CTAAAGTTCCACAAAGAAGCCAGAAAGCTTCAGTTACTCCATAG

Protein (227aa)

>JHU00006
MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELK
NLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQ
REDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP