Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05992 FUNDC1 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
19 8 17 JHU05992
19 8 18 JHU05992
HuProt v3.0
Block Row Column Clone
8 31 4 JHU05992
8 32 4 JHU05992
HuProt v3.1
Block Row Column Clone
8 31 4 JHU05992
8 32 4 JHU05992

External Database ID

Nucleotide (468bp)

>JHU05992
ATGGCGACCCGGAACCCCCCTCCCCAAGACTATGAAAGTGATGACGACTCTTATGAAGTGTTGGATTTAACTGAGTATGC
AAGAAGACACCAGTGGTGGAATCGAGTGTTTGGCCACAGTTCGGGACCTATGGTAGAAAAATACTCAGTAGCTACACAGA
TTGTAATGGGTGGCGTTACTGGCTGGTGTGCAGGATTTCTGTTCCAGAAAGTTGGAAAACTTGCAGCAACTGCAGTAGGT
GGTGGCTTTCTTCTTCTTCAGATTGCTAGTCATAGTGGCTATGTGCAGATTGACTGGAAGAGAGTTGAAAAAGATGTAAA
TAAAGCAAAAAGACAGATTAAGAAACGAGCGAACAAAGCAGCACCTGAAATCAACAATTTAATTGAAGAAGCAACAGAAT
TTATCAAGCAGAACATTGTGATATCCAGTGGATTTGTGGGAGGCTTTTTGCTCGGACTTGCATCTTAG

Protein (155aa)

>JHU05992
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVG
GGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIVISSGFVGGFLLGLAS