Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05949 ZCCHC11 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
30 8 25 JHU05949
30 8 26 JHU05949
HuProt v3.0
Block Row Column Clone
6 31 27 JHU05949
6 32 27 JHU05949
HuProt v3.1
Block Row Column Clone
6 31 27 JHU05949
6 32 27 JHU05949

External Database ID

Nucleotide (930bp)

>JHU05949
ATGGAAGAGTCTAAAACCTTAAAAAGTGAAAATCATGAACCAAAGAAGAATGTTATTTGTGAAGAAAGCAAAGCAGTTCA
AGTTATAGGTAATCAAACATTGAAAGCTAGAAATGATAAATCCGTAAAAGAAATTGAGAACAGCTCTCCAAATAGGAATA
GTAGTAAAAAAAATAAGCAAAATGATATTTGTATAGAAAAAACAGAAGTTAAATCATGTAAAGTAAATGCTGCCAACCTT
CCAGGTCCTAAAGATTTGGGGTTAGTCCTTCGAGATCAAAGTCATTGCAAAGCAAAAAAATTTCCTAATTCACCGGTGAA
AGCCGAAAAGGCAACCATTTCACAGGCAAAATCAGAAAAGGCAACCAGTTTACAGGCAATAGCAGAAAAATCACCAAAGT
CACCTAATTCAGTGAAAGCAGAAAAAGCATCCAGTTATCAGATGAAGTCAGAAAAAGTACCAAGTTCACCAGCAGAAGCA
GAAAAGGGACCCAGTTTACTGTTGAAAGACATGAGACAGAAGACAGAATTACAACAGATTGGAAAAAAAATTCCAAGCTC
CTTTACTTCTGTGGACAAAGTGAATATTGAAGCTGTAGGGGGAGAAAAATGTGCTCTGCAAAACTCACCACGATCTCAGA
AGCAACAGACATGTACAGATAATACTGGTGATTCTGATGATAGTGCTTCAGGAATTGAAGACGTATCGGACGATTTAAGT
AAAATGAAGAATGATGAATCTAATAAAGAAAATTCTTCAGAGATGGACTACTTAGAAAATGCCACTGTGATAGATGAATC
TGCATTGACACCTGAGCAGAGGCTGGGGTTGAAACAAGCAGAAGAACGCTTAGAAAGAGATCACATCTTTCGACTTGAAA
AAGTATACTATGTTGTTTTAGTTATTTGGGGGGAAATGTGTGTTTCATAG

Protein (309aa)

>JHU05949
MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQNDICIEKTEVKSCKVNAANL
PGPKDLGLVLRDQSHCKAKKFPNSPVKAEKATISQAKSEKATSLQAIAEKSPKSPNSVKAEKASSYQMKSEKVPSSPAEA
EKGPSLLLKDMRQKTELQQIGKKIPSSFTSVDKVNIEAVGGEKCALQNSPRSQKQQTCTDNTGDSDDSASGIEDVSDDLS
KMKNDESNKENSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKVYYVVLVIWGEMCVS