Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05946 VASH2 VASHL Homo sapiens Yes Secreted Proteins

HuProt v2.0
Block Row Column Clone
32 8 25 JHU05946
32 8 26 JHU05946
30 8 29 JHU05946
30 8 30 JHU05946
HuProt v3.0
Block Row Column Clone
6 31 32 JHU05946
6 32 32 JHU05946
5 31 27 JHU05946
5 32 27 JHU05946
HuProt v3.1
Block Row Column Clone
6 31 32 JHU05946
6 32 32 JHU05946
5 31 27 JHU05946
5 32 27 JHU05946

External Database ID

Nucleotide (936bp)

>JHU05946
ATGACCGGCTCCGCGGCCGACACTCACCGCTGCCCCCACCCCAAAGGCGCCAAAGGCACCCGGTCCCGGAGCAGCCACGC
GCGGCCCGTGAGCCTCGCCACCAGCGGGGGCTCAGAGGAGGAGGACAAAGACGGCGGGGTGCTGTTCCACGTCAACAAGA
GCGGCTTCCCCATCGACAGCCACACCTGGGAGCGCATGTGGATGCACGTGGCCAAGGTGCACCCTAAGGGGGGAGAAATG
GTGGGCGCCATCAGGAACGCCGCCTTCTTGGCAAAGCCTTCAATACCCCAGGTCCCAAACTACAGGCTGTCGATGACGAT
CCCAGACTGGCTCCAGGCGATCCAGAATTACATGAAGACCCTACACTACTTAACCAATGGGCAGCCTTCCATTGAGCGGT
TCCCCATCAGCTTTAAAACCTACTTCTCAGGAAACTACTTTCACCACGTTGTGCTGGGGATTTACTGCAATGGCCGCTAT
GGCTCATTGGGCATGAGCCGCAGGGCTGAGCTGATGGACAAGCCATTGACTTTTCGGACTCTGAGTGACCTCATCTTTGA
CTTTGAGGACTCTTACAAGAAATACCTGCACACAGTCAAGAAGGTCAAGATTGGGCTGTACGTCCCCCATGAGCCTCATA
GCTTCCAGCCCATTGAGTGGAAGCAGCTGGTCCTCAACGTCTCAAAGATGCTGAGGGCTGACATAAGGAAGGAGCTGGAG
AAATATGCCAGGGACATGAGAATGAAGATCCTGAAACCTGCAAGTGCCCACTCTCCGACCCAAGTGAGAAGCCGGGGAAA
ATCCCTGTCCCCCAGAAGGAGACAGGCAAGCCCCCCGAGGAGGCTCGGCCGGCGAGAGAAGTCGCCTGCACTGCCTGAAA
AGAAGGTGGCTGATCTGAGCACTCTGAATGAAGTGGGCTATCAAATCCGAATTTAG

Protein (311aa)

>JHU05946
MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEM
VGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLHYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRY
GSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELE
KYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI