Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05939 TMEM150A TMEM150 Homo sapiens Yes Kinases; Membrane Proteins

HuProt v2.0
Block Row Column Clone
8 8 29 JHU05939
8 8 30 JHU05939
HuProt v3.0
Block Row Column Clone
5 31 8 JHU05939
5 32 8 JHU05939
HuProt v3.1
Block Row Column Clone
5 31 8 JHU05939
5 32 8 JHU05939

External Database ID

Nucleotide (816bp)

>JHU05939
ATGACCGCCTGGATCCTCCTGCCTGTCAGCCTGTCAGCGTTCTCCATCACTGGCATATGGACTGTGTATGCCATGGCTGT
GATGAACCACCATGTATGCCCTGTGGAGAACTGGTCCTACAACGAGTCCTGCCCTCCTGACCCTGCTGAGCAAGGGGGTC
CCAAGACCTGCTGCACCCTGGACGATGTCCCCCTCATCAGCAAGTGTGGCTCCTATCCCCCAGAAAGCTGCCTCTTCAGC
CTCATTGGCAACATGGGTGCTTTCATGGTGGCCCTGATCTGCCTCCTGCGCTACGGGCAGCTCCTGGAGCAGAGTCGGCA
CTCTTGGGTTAACACCACGGCACTCATCACAGGCTGCACCAACGCTGCGGGCCTCTTGGTGGTTGGCAACTTTCAGGTGG
ATCATGCCAGGTCTCTGCACTACGTTGGAGCTGGCGTGGCCTTCCCTGCGGGGCTGCTCTTTGTTTGCCTGCACTGTGCT
CTCTCCTACCAAGGGGCCACCGCCCCGCTGGACCTGGCTGTGGCCTATCTGCGAAGTGTGCTGGCTGTCATCGCCTTTAT
CACCCTGGTCCTCAGTGGAGTCTTCTTTGTCCATGAGAGTTCTCAGCTGCAACATGGGGCAGCCCTGTGTGAGTGGGTGT
GTGTCATCGATATCCTCATTTTCTATGGCACCTTCAGCTACGAGTTTGGGGCAGTCTCCTCAGACACACTGGTGGCTGCA
CTGCAGCCTACCCCTGGCCGGGCCTGCAAGTCCTCCGGGAGCAGCAGCACCTCCACCCACCTCAACTGTGCCCCCGAGAG
CATCGCTATGATCTAG

Protein (271aa)

>JHU05939
MTAWILLPVSLSAFSITGIWTVYAMAVMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYPPESCLFS
LIGNMGAFMVALICLLRYGQLLEQSRHSWVNTTALITGCTNAAGLLVVGNFQVDHARSLHYVGAGVAFPAGLLFVCLHCA
LSYQGATAPLDLAVAYLRSVLAVIAFITLVLSGVFFVHESSQLQHGAALCEWVCVIDILIFYGTFSYEFGAVSSDTLVAA
LQPTPGRACKSSGSSSTSTHLNCAPESIAMI