Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05938 TMEM110 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
24 8 25 JHU05938
24 8 26 JHU05938
HuProt v3.0
Block Row Column Clone
6 31 22 JHU05938
6 32 22 JHU05938
HuProt v3.1
Block Row Column Clone
6 31 22 JHU05938
6 32 22 JHU05938

External Database ID

Nucleotide (885bp)

>JHU05938
ATGCAGGGCCCCGCCGGGAACGCGAGCCGGGGACTGCCAGGCGGGCCGCCCTCCACAGTCGCGTCCGGGGCGGGCCGCTG
CGAGAGCGGCGCGCTCATGCACAGCTTCGGCATCTTCCTGCAGGGGCTGCTCGGCGTCGTGGCCTTCAGCACGTTAATGC
TCAAACGCTTCAGAGAACCAAAGCATGAAAGACGTCCGTGGAGGATATGGTTTTTAGACACTTCCAAACAAGCCATAGGA
ATGCTGTTCATCCACTTTGCAAATGTATACCTAGCAGATCTCACTGAAGAGGACCCTTGTTCACTGTACCTCATCAACTT
CCTCCTGGACGCCACTGTGGGCATGCTGCTCATCTACGTGGGGGTGCGCGCCGTCAGCGTCCTGGTAGAGTGGCAGCAGT
GGGAGTCCCTGCGCTTCGGCGAATATGGAGACCCTCTGCAGTGTGGAGCCTGGGTCGGGCAGTGCGCTCTTTACATCGTG
ATCATGATTTTTGAAAAGTCTGTCGTCTTCATCGTCCTCCTAATACTTCAGTGGAAAAAGGTGGCCCTGTTGAATCCCAT
TGAAAACCCAGACTTGAAGCTGGCCATCGTCATGCTGATCGTCCCCTTCTTTGTCAACGCTTTGATGTTTTGGGTAGTGG
ACAATTTCCTCATGAGAAAGGGGAAGACGAAAGCTAAGCTAGAAGAAAGGGGAGCCAACCAGGACTCGAGGAATGGGAGC
AAGGTCCGCTACCGGAGGGCCGCATCCCACGAGGAGTCTGAGTCTGAGATCCTGATCTCAGCGGATGATGAGATGGAGGA
GTCCGACGTGGAGGAGGACCTCCGCAGACTGACCCCCCTCAAGCCTGTGAAGAAAAAGAAGCACCGCTTTGGGCTACCCG
TATAG

Protein (294aa)

>JHU05938
MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFSTLMLKRFREPKHERRPWRIWFLDTSKQAIG
MLFIHFANVYLADLTEEDPCSLYLINFLLDATVGMLLIYVGVRAVSVLVEWQQWESLRFGEYGDPLQCGAWVGQCALYIV
IMIFEKSVVFIVLLILQWKKVALLNPIENPDLKLAIVMLIVPFFVNALMFWVVDNFLMRKGKTKAKLEERGANQDSRNGS
KVRYRRAASHEESESEILISADDEMEESDVEEDLRRLTPLKPVKKKKHRFGLPV