Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05900 KATNA1 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
32 8 29 JHU05900
32 8 30 JHU05900
HuProt v3.0
Block Row Column Clone
5 31 32 JHU05900
5 32 32 JHU05900
HuProt v3.1
Block Row Column Clone
5 31 32 JHU05900
5 32 32 JHU05900

External Database ID

Nucleotide (936bp)

>JHU05900
ATGAGTCTTCTTATGATTAGTGAGAATGTAAAATTGGCTCGTGAATATGCATTGCTGGGAAACTATGACTCTGCGATGGT
CTATTATCAGGGAGTTCTTGACCAAATGAACAAGTATCTGTACTCAGTCAAAGATACATACCTCCAGCAGAAATGGCAAC
AGGTTTGGCAGGAAATAAATGTGGAAGCTAAACATGTTAAAGATATCATGAAAACACTAGAGAGCTTTAAACTGGACAGC
ACTCCCTTGAAAGCGGCACAGCATGACCTTCCAGCTTCTGAGGGAGAAGTCTGGTCCATGCCTGTACCTGTTGAACGAAG
ACCCTCACCAGGACCTAGAAAACGCCAATCTTCTCAGTACAGTGACCCTAAATCACATGGTAATCGTCCAAGTACAACTG
TCAGAGTTCACCGTTCATCTGCACAGAATGTTCACAATGACAGAGGGAAAGCTGTTCGTTGTCGTGAAAAGAAAGAACAG
AATAAAGGAAGAGAGGAAAAGGGAGTACTGATGGTCGGCCCACCTGGCACGGGGAAGACGCTCCTTGCTAAAGCAGTAGC
TACAGAATGCAAGACAACATTCTTCAATGTCTCTTCATCAACTTTGACTTCCAAATACAGAGGAGAATCTGAGAAGCTTG
TTCGTCTTCTGTTTGAAATGGCTCGATTTTATTCTCCAGCCACCATATTTATTGATGAGATAGACTCCATCTGTAGTCGC
CGAGGGACTTCTGAAGAACATGAAGCAAGCAGAAGGGTGAAAGCGGAGCTGCTGGTTCAGATGGATGGTGTTGGAGGTAC
TTCTGAAAATGATGACCCTTCCAAAATGGTTATGGTTCTGGCAGCTACTAATTTTCCCTGGGATATAGATGAGGCTTTAA
GACGACGCCTTGAGAAACGAATCTATATTCCTTTGCCGTCAGGGATGCGTCCTTAG

Protein (311aa)

>JHU05900
MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEINVEAKHVKDIMKTLESFKLDS
TPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQYSDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQ
NKGREEKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYSPATIFIDEIDSICSR
RGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSGMRP