Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05897 GZMK TRYP2 Homo sapiens Yes Secreted Proteins

HuProt v2.0
Block Row Column Clone
8 8 21 JHU05897
8 8 22 JHU05897
HuProt v3.0
Block Row Column Clone
7 31 8 JHU05897
7 32 8 JHU05897
HuProt v3.1
Block Row Column Clone
7 31 8 JHU05897
7 32 8 JHU05897

External Database ID

Nucleotide (795bp)

>JHU05897
ATGACTAAGTTTTCTTCCTTTTCTCTGTTTTTCCTAATAGTTGGGGCTTATATGACTCATGTGTGTTTCAATATGGAAAT
TATTGGAGGGAAAGAAGTGTCACCTCATTCCAGGCCATTTATGGCCTCCATCCAGTATGGCGGACATCACGTTTGTGGAG
GTGTTCTGATTGATCCACAGTGGGTGCTGACAGCAGCCCACTGCCAATATCGGTTTACCAAAGGCCAGTCTCCCACTGTG
GTTTTAGGCGCACACTCTCTCTCAAAGAATGAGGCCTCCAAACAAACACTGGAGATCAAAAAATTTATACCATTCTCAAG
AGTTACATCAGATCCTCAATCAAATGATATCATGCTGGTTAAGCTTCAAACAGCCGCAAAACTCAATAAACATGTCAAGA
TGCTCCACATAAGATCCAAAACCTCTCTTAGATCTGGAACCAAATGCAAGGTTACTGGCTGGGGAGCCACCGATCCAGAT
TCATTAAGACCTTCTGACACCCTGCGAGAAGTCACTGTTACTGTCCTAAGTCGAAAACTTTGCAACAGCCAAAGTTACTA
CAACGGCGACCCTTTTATCACCAAAGACATGGTCTGTGCAGGAGATGCCAAAGGCCAGAAGGATTCCTGTAAGGGTGACT
CAGGGGGCCCCTTGATCTGTAAAGGTGTCTTCCACGCTATAGTCTCTGGAGGTCATGAATGTGGTGTTGCCACAAAGCCT
GGAATCTACACCCTGTTAACCAAGAAATACCAGACTTGGATCAAAAGCAACCTTGTCCCGCCTCATACAAATTAG

Protein (264aa)

>JHU05897
MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTV
VLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPD
SLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKP
GIYTLLTKKYQTWIKSNLVPPHTN