Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00059 NME3 Homo sapiens Yes Cell Death; Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
20 1 1 JHU00059
20 1 2 JHU00059
HuProt v3.0
Block Row Column Clone
4 1 20 JHU00059
4 2 20 JHU00059
HuProt v3.1
Block Row Column Clone
4 1 20 JHU00059
4 2 20 JHU00059

External Database ID

Nucleotide (510bp)

>JHU00059
ATGATCTGCCTGGTGCTGACCATCTTCGCTAACCTCTTCCCCGCGGCCTGCACCGGCGCACACGAACGCACCTTCCTGGC
CGTGAAGCCGGACGGCGTGCAGCGGCGGCTGGTGGGCGAGATTGTGCGGCGCTTCGAGAGGAAGGGCTTCAAGTTGGTGG
CGCTGAAGCTGGTGCAGGCCTCCGAGGAGCTGCTGCGTGAGCACTACGCCGAGCTGCGTGAACGCCCGTTCTACGGCCGC
CTTGTCAAGTATATGGCCTCCGGGCCGGTGGTGGCCATGGTTTGGCAGGGGCTGGACGTGGTGCGCACCTCGCGGGCGCT
CATCGGAGCCACGAACCCGGCCGACGCCCCGCCCGGCACCATCCGCGGGGATTTCTGCATCGAGGTTGGCAAGAACCTGA
TTCACGGCAGCGACTCGGTGGAGAGTGCCCGCCGCGAGATCGCTCTCTGGTTCCGCGCAGACGAGCTCCTCTGCTGGGAG
GACAGCGCTGGGCACTGGCTGTATGAGTAG

Protein (169aa)

>JHU00059
MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGR
LVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWE
DSAGHWLYE