Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05881 EHF ESE3;ESE3B;ESEJ Homo sapiens Yes Cell Death; Kinases; Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
32 8 17 JHU05881
32 8 18 JHU05881
HuProt v3.0
Block Row Column Clone
8 31 32 JHU05881
8 32 32 JHU05881
HuProt v3.1
Block Row Column Clone
8 31 32 JHU05881
8 32 32 JHU05881

External Database ID

Nucleotide (903bp)

>JHU05881
ATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAG
CTACTCCACGTGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACC
AGGTGTGGGAGTGGCTCCAGCACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATC
AACGGCGAGCACCTCTGCAGCATGAGTTTGCAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAA
CTTGCAGCATCTGAAGTGGAACGGCCAGTGCAGTAGTGACCTGTTCCAGTCCACACACAATGTCATTGTCAAGACTGAAC
AAACTGAGCCTTCCATCATGAACACCTGGAAAGACGAGAACTATTTATATGACACCAACTATGGTAGCACAGTAGATTTG
TTGGACAGCAAAACTTTCTGCCGGGCTCAGATCTCCATGACAACCACCAGTCACCTTCCTGTTGCAGAGTCACCTGATAT
GAAAAAGGAGCAAGACCCCCCTGCCAAGTGCCACACCAAAAAGCACAACCCGAGAGGGACTCACTTATGGGAATTCATCC
GCGACATCCTCTTGAACCCAGACAAGAACCCAGGATTAATAAAATGGGAAGACCGATCTGAGGGCGTCTTCAGGTTCTTG
AAATCAGAGGCAGTGGCTCAGCTATGGGGTAAAAAGAAGAACAACAGCAGCATGACCTATGAAAAGCTCAGCCGAGCTAT
GAGATATTACTACAAAAGAGAAATTCTGGAGCGTGTGGATGGACGAAGACTGGTATATAAATTTGGGAAGAATGCCCGAG
GATGGAGAGAAAATGAAAACTAG

Protein (300aa)

>JHU05881
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDI
NGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDL
LDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFL
KSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN