Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05847 WIPI1 WIPI49 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
20 8 25 JHU05847
20 8 26 JHU05847
HuProt v3.0
Block Row Column Clone
6 31 20 JHU05847
6 32 20 JHU05847
HuProt v3.1
Block Row Column Clone
6 31 20 JHU05847
6 32 20 JHU05847

External Database ID

Nucleotide (1341bp)

>JHU05847
ATGGAGGCCGAGGCCGCGGACGCTCCCCCGGGCGGGGTTGAGTCGGCGCTCAGCTGCTTCTCTTTCAACCAGGACTGCAC
ATCCCTAGCAATTGGAACTAAAGCCGGGTATAAGCTGTTTTCTCTGAGTTCTGTGGAGCAGCTGGATCAAGTCCACGGAA
GCAATGAAATCCCGGACGTCTACATCGTGGAGCGCCTCTTCTCCAGCAGCCTGGTGGTGGTAGTCAGTCACACAAAACCA
CGGCAGATGAACGTGTATCACTTCAAGAAAGGCACAGAGATCTGTAATTACAGCTACTCCAGCAACATCTTGTCCATAAG
GCTGAACCGGCAAAGGCTGCTGGTTTGCCTAGAAGAGTCCATTTATATTCACAACATTAAAGACATGAAGCTGTTGAAGA
CCCTCCTGGATATTCCTGCAAACCCAACAGGTCTATGTGCTCTCTCTATCAACCATTCCAATTCTTACCTGGCCTATCCT
GGAAGCCTGACTTCAGGGGAGATTGTGCTTTATGATGGAAACTCCCTGAAAACAGTCTGCACTATTGCTGCCCATGAGGG
AACACTAGCTGCCATCACCTTCAATGCCTCAGGCTCCAAACTAGCAAGTGCGTCTGAAAAAGGCACAGTCATCCGGGTGT
TCTCTGTCCCTGATGGGCAAAAGCTCTATGAGTTCCGGAGAGGGATGAAAAGGTATGTGACAATCAGCTCTCTAGTGTTC
AGTATGGATTCACAATTCCTCTGCGCCTCCAGTAACACCGAGACGGTACACATCTTCAAGCTGGAACAGGTCACCAACAG
TCGACCAGAAGAGCCTTCGACCTGGAGTGGCTACATGGGAAAGATGTTTATGGCTGCTACCAACTACCTCCCTACCCAGG
TGTCAGACATGATGCATCAGGACAGGGCTTTTGCCACTGCACGCTTGAACTTCTCCGGACAGAGGAACATCTGTACCCTC
TCAACGATCCAGAAGTTGCCACGGCTGCTAGTTGCGTCATCCAGTGGACACCTTTATATGTACAATTTGGATCCTCAGGA
TGGAGGAGAGTGTGTCTTAATCAAAACCCACAGCTTGCTTGGCTCAGGAACAACAGAAGAGAATAAAGAAAATGACCTCA
GACCTTCCTTACCTCAGTCTTATGCAGCGACCGTAGCCAGACCAAGTGCATCTTCAGCCTCCACGGTGCCAGGTTATTCT
GAGGACGGCGGGGCGCTGCGAGGAGAAGTTATTCCTGAACATGAGTTTGCGACGGGACCAGTGTGTCTTGATGATGAGAA
TGAGTTTCCTCCTATAATCTTGTGCCGTGGAAATCAGAAGGGCAAAACGAAGCAGTCATAG

Protein (446aa)

>JHU05847
MEAEAADAPPGGVESALSCFSFNQDCTSLAIGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKP
RQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEESIYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYP
GSLTSGEIVLYDGNSLKTVCTIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQDRAFATARLNFSGQRNICTL
STIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYS
EDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQS