Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05817 RNMTL1 MRM3 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
2 8 29 JHU05817
2 8 30 JHU05817
HuProt v3.0
Block Row Column Clone
5 31 5 JHU05817
5 32 5 JHU05817
HuProt v3.1
Block Row Column Clone
5 31 5 JHU05817
5 32 5 JHU05817

External Database ID

Nucleotide (1263bp)

>JHU05817
ATGGCGGCGCTGGTGAGACCCTCGAGGTTTGTCGTGCGACCGTTGCTGCAGGTGGTCCAGGCTTGGGACCTTGACGCGAG
GCGCTGGGTCCGAGCGCTGCGGCGGAGCCCAGTGAAAGTGGTGTTTCCTTCCGGAGAGGTGGTGGAACAGAAGCGCGCTC
CTGGGAAGCAGCCCCGCAAGGCACCATCTGAGGCCAGTGCCCAGGAGCAACGAGAGAAACAACCGCTCGAGGAGTCCGCA
TCCCGCGCTCCCAGCACCTGGGAAGAGTCTGGGCTTCGCTACGATAAAGCTTATCCCGGGGACAGGAGGCTGAGCAGTGT
AATGACAATAGTAAAGTCCAGGCCATTTCGGGAAAAACAAGGGAAGATCCTGCTGGAAGGTCGCAGGCTCATTTCAGACG
CTCTCAAGGCTGGAGCTGTGCCAAAAATGTTCTTCTTTAGCCGTCTAGAATACCTAAAGGAGTTGCCAGTCGATAAGCTG
AAAGGTGTCAGCCTCATTAAGGTGAAATTTGAGGATATCAAGGATTGGTCCGACCTCGTAACGCCACAAGGAGTAATGGG
GATTTTTGCCAAGCCTGACCATGTTAAGATGACATATCCAAAGACTCAGCTTCAGCATTCACTGCCTTTATTATTGATTT
GTGACAATCTCCGTGACCCTGGGAACCTGGGGACAATTCTGAGATCTGCAGCTGGGGCAGGCTGCAGCAAAGTGTTACTC
ACCAAAGGCTGTGTGGATGCCTGGGAGCCCAAAGTGCTCCGGGCGGGTATGGGCGCACATTTCCGGATGCCCATTATCAA
TAATCTGGAATGGGAAACCGTGCCCAATTACCTGCCCCCTGACACTCGGGTCTATGTGGCTGACAACTGTGGCCTTTATG
CCCAGGCTGAGATGTCTAATAAAGCTAGTGACCATGGCTGGGTGTGTGATCAACGAGTGATGAAGTTTCACAAGTATGAG
GAAGAGGAAGATGTAGAAACCGGAGCCAGTCAAGATTGGCTGCCTCATGTTGAGGTTCAGAGTTACGACTCGGACTGGAC
AGAGGCGCCGGCAGCTGTGGTGATTGGCGGGGAGACCTACGGCGTGAGCCTGGAGTCCCTGCAGCTGGCCGAGAGCACTG
GTGGCAAGAGGCTGCTGATCCCCGTTGTGCCTGGTGTGGACAGCCTCAACTCGGCCATGGCGGCAAGCATCCTGCTTTTC
GAAGGGAAAAGACAGCTGCGGGGGAGGGCGGAGGACTTGAGCAGGGACAGGAGTTACCACTAG

Protein (420aa)

>JHU05817
MAALVRPSRFVVRPLLQVVQAWDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGKQPRKAPSEASAQEQREKQPLEESA
SRAPSTWEESGLRYDKAYPGDRRLSSVMTIVKSRPFREKQGKILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKL
KGVSLIKVKFEDIKDWSDLVTPQGVMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLL
TKGCVDAWEPKVLRAGMGAHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSNKASDHGWVCDQRVMKFHKYE
EEEDVETGASQDWLPHVEVQSYDSDWTEAPAAVVIGGETYGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLF
EGKRQLRGRAEDLSRDRSYH