Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00058 NME2 NM23B Homo sapiens Yes Kinases; Metabolism; Nuclear Proteins; Transcription Factors

HuProt v2.0
Block Row Column Clone
2 1 13 JHU00058
2 1 14 JHU00058
HuProt v3.0
Block Row Column Clone
1 1 5 JHU00058
1 2 5 JHU00058
HuProt v3.1
Block Row Column Clone
1 1 5 JHU00058
1 2 5 JHU00058

External Database ID

Nucleotide (459bp)

>JHU00058
ATGGCCAACCTGGAGCGCACCTTCATCGCCATCAAGCCGGACGGCGTGCAGCGCGGCCTGGTGGGCGAGATCATCAAGCG
CTTCGAGCAGAAGGGATTCCGCCTCGTGGCCATGAAGTTCCTCCGGGCCTCTGAAGAACACCTGAAGCAGCACTACATTG
ACCTGAAAGACCGACCATTCTTCCCTGGGCTGGTGAAGTACATGAACTCAGGGCCGGTTGTGGCCATGGTCTGGGAGGGG
CTGAACGTGGTGAAGACAGGCCGAGTGATGCTTGGGGAGACCAATCCAGCAGATTCAAAGCCAGGCACCATTCGTGGGGA
CTTCTGCATTCAGGTTGGCAGGAACATCATTCATGGCAGTGATTCAGTAAAAAGTGCTGAAAAAGAAATCAGCCTATGGT
TTAAGCCTGAAGAACTGGTTGACTACAAGTCTTGTGCTCATGACTGGGTCTATGAATAG

Protein (152aa)

>JHU00058
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEG
LNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE