Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05787 GART PGFT;PRGS Homo sapiens Yes Metabolism

HuProt v2.0
Block Row Column Clone
10 8 25 JHU05787
10 8 26 JHU05787
HuProt v3.0
Block Row Column Clone
6 31 15 JHU05787
6 32 15 JHU05787
HuProt v3.1
Block Row Column Clone
6 31 15 JHU05787
6 32 15 JHU05787

External Database ID

Nucleotide (1302bp)

>JHU05787
ATGGCAGCCCGAGTACTTATAATTGGCAGTGGAGGAAGGGAACATACGCTGGCCTGGAAACTTGCACAGTCTCATCATGT
CAAACAAGTGTTGGTTGCCCCAGGAAACGCAGGCACTGCCTGCTCTGAAAAGATTTCAAATACCGCCATCTCAATCAGTG
ACCACACTGCCCTTGCTCAATTCTGCAAAGAGAAGAAAATTGAATTTGTAGTTGTTGGACCAGAAGCACCTCTGGCTGCT
GGGATTGTTGGGAACCTGAGGTCTGCAGGAGTGCAATGCTTTGGCCCAACAGCAGAAGCGGCTCAGTTAGAGTCCAGCAA
AAGGTTTGCCAAAGAGTTTATGGACAGACATGGAATCCCAACCGCACAATGGAAGGCTTTCACCAAACCTGAAGAAGCCT
GCAGCTTCATTTTGAGTGCAGACTTCCCTGCTTTGGTTGTGAAGGCCAGTGGTCTTGCAGCTGGAAAAGGGGTGATTGTT
GCAAAGAGCAAAGAAGAGGCCTGCAAAGCTGTACAAGAGATCATGCAGGAGAAAGCCTTTGGGGCAGCTGGAGAAACAAT
TGTCATTGAAGAACTTCTTGACGGAGAAGAGGTGTCGTGTCTGTGTTTCACTGATGGCAAGACTGTGGCCCCCATGCCCC
CAGCACAGGACCATAAGCGATTACTGGAGGGAGATGGTGGCCCTAACACAGGGGGAATGGGAGCCTATTGTCCAGCCCCT
CAGGTTTCTAATGATCTATTACTAAAAATTAAAGATACTGTTCTTCAGAGGACAGTGGATGGCATGCAGCAAGAGGGTAC
TCCATATACAGGTATTCTCTATGCTGGAATAATGCTGACCAAGAATGGCCCAAAAGTTCTAGAGTTTAATTGCCGTTTTG
GTGATCCAGAGTGCCAAGTAATCCTCCCACTTCTTAAAAGTGATCTTTATGAAGTGATTCAGTCCACCTTAGATGGACTG
CTCTGCACATCTCTGCCTGTTTGGCTAGAAAACCACACCGCCCTAACTGTTGTCATGGCAAGTAAAGGTTATCCTGGAGA
CTACACCAAGGGTGTAGAGATAACAGGGTTTCCTGAGGCTCAAGCTCTAGGACTGGAGGTGTTCCATGCAGGCACTGCCC
TCAAAAATGGCAAAGTAGTAACTCATGGGGGTAGAGTTCTTGCAGTCACAGCCATCCGGGAAAATCTCATATCAGCCCTT
GAGGAAGCCAAGAAAGGACTAGCTGCTATAAAGTTTGAGGGAGCAATTTATAGGAAAGACGTCGGCTTTCGTGCCATAGC
TTTCCTCCAGCAGCCCAGGTAG

Protein (433aa)

>JHU05787
MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFVVVGPEAPLAA
GIVGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEACSFILSADFPALVVKASGLAAGKGVIV
AKSKEEACKAVQEIMQEKAFGAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAP
QVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKNGPKVLEFNCRFGDPECQVILPLLKSDLYEVIQSTLDGL
LCTSLPVWLENHTALTVVMASKGYPGDYTKGVEITGFPEAQALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLISAL
EEAKKGLAAIKFEGAIYRKDVGFRAIAFLQQPR