Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05786 SNX32 SNX6B Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
2 8 17 JHU05786
2 8 18 JHU05786
HuProt v3.0
Block Row Column Clone
8 31 5 JHU05786
8 32 5 JHU05786
HuProt v3.1
Block Row Column Clone
8 31 5 JHU05786
8 32 5 JHU05786

External Database ID

Nucleotide (1212bp)

>JHU05786
ATGGAGACGTATGCGGAGGTTGGCAAGGAGGGCAAGCCTTCCTGTGCATCGGTGGATCTGCAGGGAGACAGCTCCTTACA
GGTGGAGATTTCTGACGCAGTGAGTGAGCGGGACAAGGTGAAATTCACTGTTCAAACAAAGAGCTGCCTCCCTCACTTCG
CCCAGACCGAGTTCTCAGTCGTGCGGCAGCACGAGGAGTTCATCTGGCTGCATGATGCCTACGTGGAGAATGAGGAGTAC
GCCGGCCTCATCATCCCCCCAGCCCCTCCGAGGCCAGACTTTGAGGCTTCGAGGGAAAAGCTACAGAAATTGGGCGAGGG
GGACAGCTCTGTCACTCGGGAAGAGTTTGCCAAGATGAAGCAGGAGCTGGAAGCGGAGTACCTGGCCATCTTTAAGAAGA
CAGTTGCGATGCACGAAGTCTTTCTGCAGCGCCTGGCGGCCCACCCCACCCTGCGTCGAGACCACAACTTCTTTGTGTTT
TTGGAATATGGACAGGATCTGAGTGTCCGGGGGAAGAACAGGAAGGAGCTCCTCGGAGGGTTTCTGAGGAATATTGTGAA
GTCCGCGGATGAAGCCCTCATCACGGGCATGTCAGGGCTCAAGGAGGTGGATGACTTCTTTGAGCATGAGAGGACCTTCC
TGTTGGAGTATCACACCCGTATCCGAGATGCCTGCCTGCGGGCCGACCGCGTCATGCGCGCCCACAAGTGCCTGGCAGAC
GATTATATCCCTATCTCAGCTGCGCTGAGCAGTCTGGGAACACAGGAAGTCAACCAGCTAAGGACGAGCTTCCTCAAATT
GGCAGAGCTCTTTGAACGGCTGAGGAAGCTGGAGGGCCGGGTGGCTTCCGATGAGGACCTGAAGCTGTCAGACATGCTGA
GGTACTACATGCGTGACTCACAGGCAGCCAAGGACCTGCTGTACCGGCGGCTGCGGGCACTGGCCGACTACGAGAATGCC
AACAAGGCGCTGGACAAGGCGCGCACCAGGAACCGGGAGGTGCGGCCCGCCGAGAGCCACCAGCAGCTGTGCTGCCAACG
CTTCGAGCGCCTCTCCGACTCCGCCAAGCAAGAGCTCATGGACTTCAAGTCCCGCCGGGTCTCCTCTTTTCGAAAGAATC
TCATTGAGCTGGCAGAGCTGGAGCTCAAACACGCCAAGGCCAGCACCCTGATTCTCCGGAACACCCTTGTTGCCCTAAAG
GGGGAGCCTTAG

Protein (403aa)

>JHU05786
METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSVVRQHEEFIWLHDAYVENEEY
AGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMKQELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVF
LEYGQDLSVRGKNRKELLGGFLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLAD
DYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALADYENA
NKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELMDFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALK
GEP