Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU05782 ENPP7 Homo sapiens Yes Metabolism; Secreted Proteins

HuProt v2.0
Block Row Column Clone
28 8 17 JHU05782
28 8 18 JHU05782
HuProt v3.0
Block Row Column Clone
8 31 26 JHU05782
8 32 26 JHU05782
HuProt v3.1
Block Row Column Clone
8 31 26 JHU05782
8 32 26 JHU05782

External Database ID

Nucleotide (1377bp)

>JHU05782
ATGAGAGGCCCGGCCGTCCTCCTCACTGTGGCTCTGGCCACGCTCCTGGCTCCCGGGGCCGGAGCACCGGTACAAAGTCA
GGGCTCCCAGAACAAGCTGCTCCTGGTGTCCTTCGACGGCTTCCGCTGGAACTACGACCAGGACGTGGACACCCCCAACC
TGGACGCCATGGCCCGAGACGGGGTGAAGGCACGCTACATGACCCCCGCCTTTGTCACCATGACCAGCCCCTGCCACTTC
ACCCTGGTCACCGGCAAATATATCGAGAACCACGGGGTGGTTCACAACATGTACTACAACACCACCAGCAAGGTGAAGCT
GCCCTACCACGCCACGCTGGGCATCCAGAGGTGGTGGGACAACGGCAGCGTGCCCATCTGGATCACAGCCCAGAGGCAGG
GCCTGAGGGCTGGCTCCTTCTTCTACCCGGGCGGGAACGTCACCTACCAAGGGGTGGCTGTGACGCGGAGCCGGAAAGAA
GGCATCGCACACAACTACAAAAATGAGACGGAGTGGAGAGCGAACATCGACACAGTGATGGCGTGGTTCACAGAGGAGGA
CCTGGATCTGGTCACACTCTACTTCGGGGAGCCGGACTCCACGGGCCACAGGTACGGCCCCGAGTCCCCGGAGAGGAGGG
AGATGGTGCGGCAGGTGGACCGGACCGTGGGCTACCTCCGGGAGAGCATCGCGCGCAACCACCTCACAGACCGCCTCAAC
CTGATCATCACATCCGACCACGGCATGACGACCGTGGACAAACGGGCTGGCGACCTGGTTGAATTCCACAAGTTCCCCAA
CTTCACCTTCCGGGACATCGAGTTTGAGCTCCTGGACTACGGACCAAACGGGATGCTGCTCCCTAAAGAAGGGAGGCTGG
AGAAGGTGTACGATGCCCTCAAGGACGCCCACCCCAAGCTCCACGTCTACAAGAAGGAGGCGTTCCCCGAGGCCTTCCAC
TACGCCAACAACCCCAGGGTCACACCCCTGCTGATGTACAGCGACCTTGGCTACGTCATCCATGGGAGAATTAACGTCCA
GTTCAACAATGGGGAGCACGGCTTTGACAACAAGGACATGGACATGAAGACCATCTTCCGCGCTGTGGGCCCTAGCTTCA
GGGCGGGCCTGGAGGTGGAGCCCTTTGAGAGCGTCCACGTGTACGAGCTCATGTGCCGGCTGCTGGGCATCGTGCCCGAG
GCCAACGATGGGCACCTAGCTACTCTGCTGCCCATGCTGCACACAGAATCTGCTCTTCCGCCTGATGGAAGGCCTACTCT
CCTGCCCAAGGGAAGATCTGCTCTCCCGCCCAGCAGCAGGCCCCTCCTCGTGATGGGACTGCTGGGGACCGTGATTCTTC
TGTCTGAGGTCGCATAG

Protein (458aa)

>JHU05782
MRGPAVLLTVALATLLAPGAGAPVQSQGSQNKLLLVSFDGFRWNYDQDVDTPNLDAMARDGVKARYMTPAFVTMTSPCHF
TLVTGKYIENHGVVHNMYYNTTSKVKLPYHATLGIQRWWDNGSVPIWITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKE
GIAHNYKNETEWRANIDTVMAWFTEEDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLN
LIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAFPEAFH
YANNPRVTPLLMYSDLGYVIHGRINVQFNNGEHGFDNKDMDMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPE
ANDGHLATLLPMLHTESALPPDGRPTLLPKGRSALPPSSRPLLVMGLLGTVILLSEVA