Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00057 NME1 NDPKA;NM23 Homo sapiens Yes Cell Death; Kinases; Metabolism; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
4 1 7 JHU00057
4 1 8 JHU00057
HuProt v3.0
Block Row Column Clone
3 3 20 JHU00057
3 4 20 JHU00057
HuProt v3.1
Block Row Column Clone
3 3 20 JHU00057
3 4 20 JHU00057
21 45 16 JHU00057
21 46 16 JHU00057

External Database ID

Nucleotide (459bp)

>JHU00057
ATGGCCAACTGTGAGCGTACTTTCATTGCGATCAAACCAGATGGGGTCCAGCGGGGTCTTGTGGGAGAGATTATCAAGCG
TTTTGAGCAGAAAGGATTCCGCCTTGTTGGTCTGAAATTCATGCAAGCTTCCGAAGATCTTCTCAAGGAACACTACGTTG
ACCTGAAGGACCGTCCATTCTTTGCCGGCCTGGTGAAATACATGCACTCAGGGCCGGTAGTTGCCATGGTCTGGGAGGGG
CTGAATGTGGTGAAGACGGGCCGAGTCATGCTCGGGGAGACCAACCCTGCAGACTCCAAGCCTGGGACCATCCGTGGAGA
CTTCTGCATACAAGTTGGCAGGAACATTATACATGGCAGTGATTCTGTGGAGAGTGCAGAGAAGGAGATCGGCTTGTGGT
TTCACCCTGAGGAACTGGTAGATTACACGAGCTGTGCTCAGAACTGGATCTATGAATAG

Protein (152aa)

>JHU00057
MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEG
LNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE