Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00056 NAGK Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
10 1 11 JHU00056
10 1 12 JHU00056
HuProt v3.0
Block Row Column Clone
2 3 23 JHU00056
2 4 23 JHU00056
HuProt v3.1
Block Row Column Clone
2 3 23 JHU00056
2 4 23 JHU00056

External Database ID

Nucleotide (1035bp)

>JHU00056
ATGGCCGCGATCTATGGGGGTGTAGAGGGGGGAGGCACACGATCCGAGGTCCTTTTAGTCTCAGAGGATGGGAAGATCCT
GGCAGAAGCAGATGGACTGAGCACAAACCACAGGCTGATCGGGACAGACAAGTGTGTGGAGAGGATCAATGAGATGGTGA
ACAGGGCCAAACGGAAAGTAGGGGTGGATCCTCTGGTACCGCTGCGAAGCTTGGGCCTATCTCTGAGCGGTGGGGACCAG
GAGGACGCGGGGAGGATCCTGATCGAGGAGCTGAGGGACCGATTTCCCTACCTGAGTGAAAGCTACTTAATCACCACCGA
TGCCGCCGGCTCCATCGCCACAGCTACACCGGATGGTGGAGTTGTGCTCATATCTGGAACAGGCTCCAACTGCAGGCTCA
TCAACCCTGATGGCTCCGAGAGTGGCTGCGGCGGCTGGGGCCATATGATGGGTGATGAGGGTTCAGCCTACTGGATCGCA
CACCAAGCAGTGAAAATAGTGTTTGACTCCATTGACAACCTAGAGGCGGCTCCTCATGATATCGGCTACGTCAAACAGGC
CATGTTCCACTATTTCCAGGTGCCAGATCGGCTAGGGATACTCACTCACCTGTATAGGGACTTTGATAAATGCAGGTTTG
CTGGGTTTTGCCGGAAAATTGCAGAAGGTGCTCAGCAGGGAGACCCCCTTTCCCGCTATATCTTCAGGAAGGCTGGGGAG
ATGCTGGGCAGACACATCGTAGCAGTGTTGCCCGAGATTGACCCGGTCTTGTTCCAGGGCAAGATTGGACTCCCCATCCT
GTGCGTGGGCTCTGTGTGGAAGAGCTGGGAGCTGCTGAAGGAAGGTTTTCTTCTGGCGCTGACCCAGGGCAGAGAGATCC
AGGCTCAGAACTTCTTCTCCAGCTTCACCCTGATGAAGCTGAGGCACTCCTCCGCTCTGGGTGGGGCCAGCCTAGGGGCC
AGGCACATCGGGCACCTCCTCCCCATGGACTATAGCGCCAATGCCATTGCCTTCTATTCCTACACCTTTTCCTAG

Protein (344aa)

>JHU00056
MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHRLIGTDKCVERINEMVNRAKRKVGVDPLVPLRSLGLSLSGGDQ
EDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIA
HQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGE
MLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGA
RHIGHLLPMDYSANAIAFYSYTFS