Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00055 NAGK Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
4 1 13 JHU00055
4 1 14 JHU00055
HuProt v3.0
Block Row Column Clone
1 1 2 JHU00055
1 2 2 JHU00055
HuProt v3.1
Block Row Column Clone
1 1 2 JHU00055
1 2 2 JHU00055

External Database ID

Nucleotide (1035bp)

>JHU00055
ATGGCCGCGATCTATGGGGGTGTAGAGGGGGGAGGCACACGATCCGAGGTCCTTTTAGTCTCAGAGGATGGGAAGATCCT
GGCAGAAGCAGATGGACTGAGCACAAACCACTGGCTGATCGGGACAGACAAGTGTGTGGAGAGGATCAATGAGATGGTGA
ACAGGGCCAAACGGAAAGCAGGGGTGGATCCTCTGGTACCGCTGCGAAGCTTGGGCCTATCTCTGAGCGGTGGGGACCAG
GAGGACGCGGGGAGGATCCTGATCGAGGAGCTCAGGGACCGATTTCCCTACCTGAGTGAAAGCTACTTAATCACCACCGA
TGCCGCCGGCTCCATCGCCACAGCTACACCGGATGGTGGAGTTGTGCTCATATCTGGAACAGGCTCCAACTGCAGGCTCA
TCAACCCTGATGGCTCCGAGAGTGGCTGCGGCGGCTGGGGCCATATGATGGGTGATGAGGGTTCAGCCTACTGGATCGCA
CACCAAGCAGTGAAAATAGTGTTTGACTCCATTGACAACCTAGAGGCGGCTCCTCATGATATCGGCTACGTCAAACAGGC
CATGTTCCACTATTTCCAGGTGCCAGATCGGCTAGGGATACTCACTCACCTGTATAGGGACTTTGATAAATGCAGGTTTG
CTGGGTTTTGCCGGAAAATTGCAGAAGGTGCTCAGCAGGGAGACCCCCTTTCCCGCTATATCTTCAGGAAGGCTGGGGAG
ATGCTGGGCAGACACATCGTAGCAGTGTTGCCCGAGATTGACCCGGTCTTGTTCCAGGGCAAGATTGGACTCCCCATCCT
GTGCGTGGGCTCTGTGTGGAAGAGCTGGGAGCTGCTGAAGGAAGGTTTTCTTCTGGCGCTGACCCAGGGCAGAGAGATCC
AGGCTCAGAACTTCTTCTCCAGCTTCACCCTGATGAAGCTGAGGCACTCCTCCGCTCTGGGTGGGGCCAGCCTAGGGGCC
AGGCACATCGGGCACCTCCTCCCCATGGACTATAGCGCCAATGCCATTGCCTTCTATTCCTACACCTTTTCCTAG

Protein (344aa)

>JHU00055
MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQ
EDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIA
HQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGE
MLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGA
RHIGHLLPMDYSANAIAFYSYTFS