Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00054 MVK Homo sapiens Yes Kinases; Metabolism

HuProt v2.0
Block Row Column Clone
20 1 11 JHU00054
20 1 12 JHU00054
37 24 25 JHU00054
37 24 26 JHU00054
HuProt v3.0
Block Row Column Clone
2 5 2 JHU00054
2 6 2 JHU00054
18 45 7 JHU00054
18 46 7 JHU00054
HuProt v3.1
Block Row Column Clone
2 5 2 JHU00054
2 6 2 JHU00054
18 45 7 JHU00054
18 46 7 JHU00054

External Database ID

Nucleotide (1191bp)

>JHU00054
ATGTTGTCAGAAGTCCTACTGGTGTCTGCTCCGGGGAAAGTCATCCTTCATGGAGAACATGCCGTGGTACATGGCAAGGT
AGCACTGGCTGTATCCTTGAACTTGAGAACATTCCTCCGGCTTCAACCCCACAGCAATGGGAAAGTGGACCTCAGCTTAC
CCAACATTGGTATCAAGCGGGCCTGGGATGTGGCCAGGCTTCAGTCACTGGACACAAGCTTTCTGGAGCAAGGTGATGTC
ACAACACCCACCTCAGAGCAAGTGGAGAAGCTAAAGGAGGTTGCAGGCTTGCCTGACGACTGTGCTGTCACCGAGCGCCT
GGCTGTGCTGGCCTTTCTTTACTTATACCTGTCCATCTGCCGGAAGCAGAGGGCCCTGCCGAGCCTGGATATCGTAGTGT
GGTCGGAGCTGCCCCCCGGGGCGGGCTTGGGCTCCAGCGCCGCCTACTCGGTGTGTCTGGCAGCAGCCCTCCTGACTGTG
TGCGAGGAGATCCCAAACCCGCTGAAGGACGGGGATTGCGTCAACAGGTGGACCAAGGAGGATTTGGAGCTAATTAACAA
GTGGGCCTTCCAAGGGGAGAGAATGATTCACGGGAACCCCTCCGGAGTGGACAATGCTGTCAGCACCTGGGGAGGAGCCC
TCCGATACCATCAAGGGAAGATTTCATCCTTAAAGAGGTCGCCAGCTCTCCAGATCCTGCTGACCAACACCAAAGTCCCT
CGCAATACCAGGGCCCTTGTGGCTGGCGTCAGAAACAGGCTGCTCAAGTTCCCAGAGATCGTGGCCCCCCTCCTGACCTC
AATAGATGCCATCTCCCTGGAGTGTGAGCGCGTGCTGGGAGAGATGGGGGAAGCCCCAGCCCCGGAGCAGTACCTCGTGC
TGGAAGAGCTCATTGACATGAACCAGCACCATCTGAATGCCCTCGGCGTGGGCCACGCCTCTCTGGACCAGCTCTGCCAG
GTGACCAGGGCCCGCGGACTTCACAGCAAGCTGACTGGCGCAGGCGGTGGTGGCTGTGGCATCACACTCCTCAAGCCAGG
GCTGGAGCAGCCAGAAGTGGAGGCCACGAAGCAGGCCCTGACCAGCTGTGGCTTTGACTGCTTGGAAACCAGCATCGGTG
CCCCCGGCGTCTCCATCCACTCAGCCACCTCCCTGGACAGCCGAGTCCAGCAAGCCCTGGATGGCCTCTAG

Protein (396aa)

>JHU00054
MLSEVLLVSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARLQSLDTSFLEQGDV
TTPTSEQVEKLKEVAGLPDDCAVTERLAVLAFLYLYLSICRKQRALPSLDIVVWSELPPGAGLGSSAAYSVCLAAALLTV
CEEIPNPLKDGDCVNRWTKEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSPALQILLTNTKVP
RNTRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLGEMGEAPAPEQYLVLEELIDMNQHHLNALGVGHASLDQLCQ
VTRARGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL