Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00053 MKNK2 Homo sapiens Yes Kinases

HuProt v2.0
Block Row Column Clone
23 24 27 JHU00053
23 24 28 JHU00053
HuProt v3.0
Block Row Column Clone
18 47 10 JHU00053
18 48 10 JHU00053
HuProt v3.1
Block Row Column Clone
18 47 10 JHU00053
18 48 10 JHU00053

External Database ID

Nucleotide (477bp)

>JHU00053
ATGGCCCCGGAGGTAGTGGAGGCCTTCAGCGAGGAGGCTAGCATCTACGACAAGCGCTGCGACCTGTGGAGCCTGGGCGT
CATCTTGTATATCCTACTCAGCGGCTACCCGCCCTTCGTGGGCCGCTGTGGCAGCGACTGCGGCTGGGACCGCGGCGAGG
CCTGCCCTGCCTGCCAGAACATGCTGTTTGAGAGCATCCAGGAGGGCAAGTACGAGTTCCCCGACAAGGACTGGGCCCAC
ATCTCCTGCGCTGCCAAAGACCTCATCTCCAAGCTGCTGGTCCGTGACGCCAAGCAGAGGCTGAGTGCCGCCCAAGTCCT
GCAGCACCCCTGGGTTCAGGGGTGCGCCCCGGAGAACACCTTGCCCACTCCCATGGTCCTGCAGAGGTGGGACAGTCACT
TCCTCCTCCCTCCCCACCCCTGTCGCATCCACGTGCGACCTGGAGGACTGGTCAGAACCGTTACTGTGAATGAGTAG

Protein (158aa)

>JHU00053
MAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAH
ISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQRWDSHFLLPPHPCRIHVRPGGLVRTVTVNE