Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00052 MKNK1 MNK1 Homo sapiens Yes Kinases; Nuclear Proteins; Signal Transduction

HuProt v2.0
Block Row Column Clone
28 1 1 JHU00052
28 1 2 JHU00052
HuProt v3.0
Block Row Column Clone
4 1 26 JHU00052
4 2 26 JHU00052
HuProt v3.1
Block Row Column Clone
4 1 26 JHU00052
4 2 26 JHU00052
23 45 13 JHU00052
23 46 13 JHU00052

External Database ID

Nucleotide (1398bp)

>JHU00052
ATGGTATCTTCTCAAAAGTTGGAAAAACCTATAGAGATGGGCAGTAGCGAACCCCTTCCCATCGCAGATGGTGACAGGAG
GAGGAAGAAGAAGCGGAGGGGCCGGGCCACTGACTCCTTGCCAGGAAAGTTTGAAGATATGTACAAGCTGACCTCTGAAT
TGCTTGGAGAGGGAGCCTATGCCAAAGTTCAAGGTGCCGTGAGCCTACAGAATGGCAAAGAGTATGCCGTCAAAATCATC
GAGAAACAAGCAGGGCACAGTCGGAGTAGGGTGTTTCGAGAGGTGGAGACGCTGTATCAGTGTCAGGGAAACAAGAACAT
TTTGGAGCTGATTGAGTTCTTTGAAGATGACACAAGGTTTTACTTGGTCTTTGAGAAATTGCAAGGAGGTTCCATCTTAG
CCCACATCCAGAAGCAAAAGCACTTCAATGAGCGAGAAGCCAGCCGAGTGGTGCGGGACGTTGCTGCTGCCCTTGACTTC
CTGCATACCAAAGACAAAGTCTCTCTCTGTCACCTAGGCTGGAGTGCTATGGCGCCATCAGGGCTCACTGCAGCCCCAAC
CTCCCTGGGCTCCAGTGATCCTCCCACCTCAGCCTCCCAAGTAGCTGGGACTACAGGCATTGCTCATCGTGATCTGAAAC
CAGAAAATATATTGTGTGAATCTCCAGAAAAGGTGTCTCCAGTGAAAATCTGTGACTTTGACTTGGGCAGTGGGATGAAA
CTGAACAACTCCTGTACCCCCATAACCACACCAGAGCTGACCACCCCATGTGGCTCTGCAGAATACATGGCCCCTGAGGT
AGTGGAGGTCTTCACGGACCAGGCCACATTCTACGACAAGCGCTGTGACCTGTGGAGCCTGGGCGTGGTCCTCTACATCA
TGCTGAGTGGCTACCCACCCTTCGTGGGTCACTGCGGGGCCGACTGTGGCTGGGACCGGGGCGAGGTCTGCAGGGTGTGC
CAGAACAAGCTGTTTGAAAGCATCCAGGAAGGCAAGTATGAGTTTCCTGACAAGGACTGGGCACACATCTCCAGTGAAGC
CAAAGACCTCATCTCCAAGCTCCTGGTGCGAGATGCAAAGCAGAGACTTAGCGCCGCCCAAGTTCTGCAGCACCCATGGG
TGCAGGGGCAAGCTCCAGAAAAGGGACTCCCCACGCCGCAAGTCCTCCAGAGGAACAGCAGCACAATGGACCTGACGCTC
TTCGCAGCTGAGGCCATCGCCCTTAACCGCCAGCTATCTCAGCACGAAGAGAACGAACTAGCAGAGGAGCCAGAGGCACT
AGCTGATGGCCTCTGCTCCATGAAGCTTTCCCCTCCCTGCAAGTCACGCCTGGCCCGGAGACGGGCCCTGGCCCAGGCAG
GCCGTGGTGAAGACAGGAGCCCGCCCACAGCACTCTAG

Protein (465aa)

>JHU00052
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEYAVKII
EKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDF
LHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGSGMK
LNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKRCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVC
QNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTL
FAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL