Clone info
System ID Symbol Synonyms Species Has StopCodon Categories
JHU00051 MCTP2 Homo sapiens Yes

HuProt v2.0
Block Row Column Clone
29 24 27 JHU00051
29 24 28 JHU00051
HuProt v3.0
Block Row Column Clone
18 47 13 JHU00051
18 48 13 JHU00051
HuProt v3.1
Block Row Column Clone
18 47 13 JHU00051
18 48 13 JHU00051

External Database ID

Nucleotide (921bp)

>JHU00051
ATGGGCATTTTGGACATTGAAGTGTGGGGAAAGGACAACAAAAAGCATGAGGAACGTCTGGGCACGTGTAAAGTGGATAT
CTCGGCACTCCCTCTGAAGCAAGCCAACTGCCTGGAGCTGCCACTGGACAGCTGTCTGGGGGCTCTCCTTATGTTGGTCA
CACTTACACCCTGTGCGGGGGTCTCCGTCTCTGATCTGTGTGTCTGCCCCTTAGCAGACCTCAGCGAAAGAAAGCAGATT
ACCCAGCGATATTGCTTACAGAACTCCCTGAAAGATGTGAAAGACGTCGGCATTCTACAAGTGAAGGTTTTAAAGGCAGC
AGATCTCTTAGCGGCAGATTTCTCAGGGAAGAGTGACCCATTTTGCTTGTTGGAGTTAGGCAATGACCGACTTCAGACGC
ATACCGTCTACAAAAACCTCAACCCTGAATGGAACAAAGTTTTTACATTTCCCATTAAAGATATCCATGATGTTTTGGAA
GTGACAGTGTTTGATGAAGATGGAGATAAACCCCCAGATTTTCTTGGAAAAGTTGCCATTCCCTTGCTGTCCATTAGAGA
TGGACAACCGAATTGTTATGTACTAAAGAATAAAGATTTAGAACAAGCTTTTAAAGGAGTTATTTACTTAGAGATGGACC
TTATATATAATCCGGTGAAAGCAAGTATTAGGACTTTTACTCCCCGGGAAAAGCGCTTTGTTGAAGACAGCCGCAAGCTG
TCCAAAAAGATCTTATCAAGAGATGTGGACCGTGTGAAAAGAATCACTATGGCAATATGGAATACAATGCAGTTCCTTAA
AAGCTGCTTCCAGTGGGAATCCACATTAAGAAGTACAATAGCATTCGCGCACCGCAAAGAGGAACCACCCCTGTCTATGA
AATGTACCCTTTTCTCTGGTGACATTGGCCCATCCTTATAG

Protein (306aa)

>JHU00051
MGILDIEVWGKDNKKHEERLGTCKVDISALPLKQANCLELPLDSCLGALLMLVTLTPCAGVSVSDLCVCPLADLSERKQI
TQRYCLQNSLKDVKDVGILQVKVLKAADLLAADFSGKSDPFCLLELGNDRLQTHTVYKNLNPEWNKVFTFPIKDIHDVLE
VTVFDEDGDKPPDFLGKVAIPLLSIRDGQPNCYVLKNKDLEQAFKGVIYLEMDLIYNPVKASIRTFTPREKRFVEDSRKL
SKKILSRDVDRVKRITMAIWNTMQFLKSCFQWESTLRSTIAFAHRKEEPPLSMKCTLFSGDIGPSL